NHE3/SLC9A3 Antibody - BSA Free

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Analysis in human colon and liver tissues using NBP1-82574 antibody. Corresponding SLC9A3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon, kidney, liver and small intestine using Anti-SLC9A3 antibody NBP1-82574 (A) shows similar protein distribution across tissues to independent antibody NBP1-82575 (B).

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human liver shows no membranous positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human colon shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human gallbladder shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human kidney shows weak positivity in apical membrane in cells in tubules.

Immunohistochemistry-Paraffin: NHE3/SLC9A3 Antibody [NBP1-82574] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.

• Reactivity: Hu, Mu, Po
• Applications: WB, ICC/IF, IHC, PAGE
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NHE3/SLC9A3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPEST
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC9A3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 32502894).
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID 26677983)
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • SDS-Page Reported in scientific literature (PMID: 32738496).
  • Western Blot Reported in scientific literature (PMID: 32738496).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NHE3/SLC9A3 Protein (NBP1-82574PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 29196502). Use in Porcine reported in scientific publication (PMID: 32738496).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NHE3/SLC9A3 Antibody - BSA Free

• isoform 3
• MGC126718
• NHE3
• NHE3MGC126720
• SLC9A3
• solute carrier family 9 (sodium/hydrogen exchanger), member 3
• Solute carrier family 9 member 3

Background

NHE3 is a member of the Sodium/Hydrogen exchanger family that plays a crucial role in acid-base and volume homeostasis by mediating the majority of sodium and bicarbonate reabsorption in the proximal tubule of the kidney. Two PKA consensus sites have been discovered in rat NHE3, serine 552 and serine 605. Research suggests that dopamine-induced phosphorylation of these consensus sites inhibit NHE3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NHE3/SLC9A3 Antibody (NBP1-82574)(31)

Publications using NBP1-82574

• Mahdi Amiri, Min Jiang, Azam Salari, Renjie Xiu, Seth L. Alper, Ursula E. Seidler Reduced surface pH and upregulated AE2 anion exchange in SLC26A3-deleted polarized intestinal epithelial cells American Journal of Physiology - Cell Physiology 2024-03-01 [PMID: 38223928]
• Kim YH, Lee YK, Park SS et al. Mid-old cells are a potential target for anti-aging interventions in the elderly Nature communications 2023-11-22 [PMID: 37993434] (IHC-P, Mouse, Human)
• Ruichao Yue, Xiaoyuan Wei, Liuyi Hao, Haibo Dong, Wei Guo, Xinguo Sun, Jiangchao Zhao, Zhanxiang Zhou, Wei Zhong Promoting intestinal antimicrobial defense and microbiome symbiosis contributes to IL-22-mediated protection against alcoholic hepatitis in mice Frontiers in Immunology 2023-10-16 [PMID: 37908362]
• Mödl B, Awad M, Zwolanek D et al. Defects in microvillus crosslinking sensitize to colitis and inflammatory bowel disease EMBO reports 2023-09-11 [PMID: 37691494] (WB, ICC/IF, Mouse)
• Kunke, M;Knöfler, H;Dahlke, E;Zanon Rodriguez, L;Böttner, M;Larionov, A;Saudenova, M;Ohrenschall, GM;Westermann, M;Porubsky, S;Bernardes, JP;Häsler, R;Magnin, JL;Koepsell, H;Jouret, F;Theilig, F; Targeted deletion of von-Hippel-Lindau in the proximal tubule conditions the kidney against early diabetic kidney disease Cell death & disease 2023-08-26 [PMID: 37626062]
• Zachos NC, Vaughan H, Sarker R et al. A NOVEL PEPTIDE PREVENTS ENTEROTOXIN- AND INFLAMMATION-INDUCED INTESTINAL FLUID SECRETION BY STIMULATING NHE3 ACTIVITY Gastroenterology 2023-07-08 [PMID: 37429363]
• Peritore-Galve FC, Kaji I, Smith A et al. Increased intestinal permeability and downregulation of absorptive ion transporters Nhe3, Dra, and Sglt1 contribute to diarrhea during Clostridioides difficile infection Gut microbes 2023-06-23 [PMID: 37350393] (IHC-P, Mouse)
• Salari A, Zhou K, Nikolovska K et al. Human Colonoid-Myofibroblast Coculture for Study of Apical Na+/H+ Exchangers of the Lower Cryptal Neck Region International journal of molecular sciences 2023-02-21 [PMID: 36901695] (WB, ICC/IF, Human)
• Hiltz RL, McCurdy DE, Moreland S et al. Effects of weaning on regulators of volatile fatty acid absorption and intracellular pH in Holstein calves JDS Communications 2021-11-01 [PMID: 36337096]
• Donowitz M, Sarker R, Lin R et al. Identification of Intestinal NaCl Absorptive-Anion Secretory Cells: Potential Functional Significance Frontiers in Physiology 2022-07-19 [PMID: 35928564]
• Duclaux-Loras R, Lebreton C, Berthelet J et al. UNC45A deficiency causes microvillus inclusion disease-like phenotype by impairing myosin VB-dependent apical trafficking The Journal of clinical investigation 2022-05-16 [PMID: 35575086] (IF/IHC, ICC/IF, Human)
• Haynes J, Palaniappan B, Tsopmegha E, Sundaram U Regulation of nutrient and electrolyte absorption in human organoid-derived intestinal epithelial cell monolayers Translational Research 2022-05-01 [PMID: 35513245]
• Yanda MK, Cebotaru L VX-809 mitigates disease in a mouse model of autosomal dominant polycystic kidney disease bearing the R3277C human mutation FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2021-11-01 [PMID: 34662459]
• Zhou K, Amiri M, Salari A Et Al. Functional characterization of the sodium/hydrogen exchanger 8 and its role in prolifeRation of colonic epithelial cells American journal of physiology. Cell physiology 2021-07-21 [PMID: 34288721]
• Yue R, Wei X, Zhao J et al. Essential Role of IFN-? in Regulating Gut Antimicrobial Peptides and Microbiota to Protect Against Alcohol-Induced Bacterial Translocation and Hepatic Inflammation in Mice Frontiers in Physiology 2021-01-18 [PMID: 33536944]
• Zhang, J, Huang, Y J Et al. Primary human colonic mucosal barrier crosstalk with super oxygen-sensitive Faecalibacterium prausnitzii in continuous culture. Med (N Y) 2021-01-15 [PMID: 33511375] (IF/IHC, Human)
• Yin J, Sunuwar L, Kasendra M et al. Fluid Shear Stress Enhances Differentiation of Jejunal Human Enteroids in Intestine-Chip Am J Physiol Gastrointest Liver Physiol 2020-10-14 [PMID: 33074011]
• Klinger S Segment specific effects of resveratrol on porcine small intestinal dipeptide absorption depend on the mucosal pH and are due to different mechanisms: Potential roles of different transport proteins and protein kinases J. Nutr. Biochem. 2020-07-29 [PMID: 32738496] (WB, SDS-Page, Porcine)
• Hernandez-Gordillo V, Kassis T, Lampejo A et al. Fully synthetic matrices for in vitro culture of primary human intestinal enteroids and endometrial organoids Biomaterials 2020-01-01 [PMID: 32502894] (ICC/IF, Mouse, Human)
• Chen T, Lin R, Avula L et al. NHERF3 is Necessary for E. coli Heat Stable Enterotoxin (ST)-induced Inhibition of NHE3 - Differences in Signaling in Mouse Small Intestine and Caco-2 Cells Am. J. Physiol., Cell Physiol. 2019-07-31 [PMID: 31365292]
• Pinette JA, Mao S, Millis BA et al. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo Mol. Biol. Cell 2019-01-01 [PMID: 30403560] (IHC-P, Mouse)
• Engevik AC, Kaji I, Engevik MA et al. Loss of MYO5B Leads to Reductions in Na+ Absorption with Maintenance of CFTR-dependent Cl- Secretion in Enterocytes Gastroenterology 2018-08-22 [PMID: 30144427] (IF/IHC, Mouse)
• Schlegel C, Lapierre LA, Weis VG et al. Reversible deficits in apical transporter trafficking associated with DGAT1 deficiency Traffic 2018-08-10 [PMID: 30095213] (Human)
• Hernandez-Gordillo V, Kassis T, Lampejo A, Choi GH Niche-inspired synthetic matrices for epithelial organoid culture bioRxiv
• Zachos NC, Baetz NW, Gupta A et al. Human Rotavirus Diarrhea Is Associated with Altered Trafficking and Expression of Apical Membrane Transport Proteins bioRxiv 2019-09-26 (ICC/IF)
• Singh V, Yang J, Yin J et al. Cholera toxin inhibits SNX27-retromer mediated delivery of cargo proteins to the plasma membrane. J. Cell. Sci. 2018-07-20 [PMID: 30030371] (WB, Human)
• Yin J, Tse CM, Avula LR et al. Molecular Basis and Differentiation-Associated Alterations of Anion Secretion in Human Duodenal Enteroid Monolayers Cell Mol Gastroenterol Hepatol 2018-02-09 [PMID: 29930980] (WB, Human)
• Rajkumar P, Cha B, Yin J et al. Identifying the localization and exploring a functional role for Gprc5c in the kidney. FASEB J. 2017-12-01 [PMID: 29196502] (Mouse)
• Yin, J, Tse, C M Et al. A common NHE3 single-nucleotide polymorphism has normal function and sensitivity to regulatory ligands. Am J Physiol Gastrointest Liver Physiol 2017-08-01 [PMID: 28495802] (FLOW, Human)
• Foulke-Abel J, In J, Yin J et al. Human Enteroids as a Model of Upper Small Intestinal Ion Transport Physiology and Pathophysiology. Gastroenterology. 2015-12-08 [PMID: 26677983] (WB, IHC-Fr, Human)
• Engevik MA, Engevik KA, Yacyshyn MB et al. Human Clostridium difficile infection: Inhibition of NHE3 and microbiota profile. Am. J. Physiol. Gastrointest. Liver Physiol. 2014-12-31 [PMID: 25552580]

FAQs for NHE3/SLC9A3 Antibody (NBP1-82574). (Showing 1 - 1 of 1 FAQs).

1. The molecular weight of NHE3 is 92kDa but I see a band above 100 kDa.  I am confused, because the size of these protein should not be greater than 100KD. Can you please help explain?  
   • Higher than predicted molecular weight seen on WB is not uncommon if the protein is posttranslationally modified, especially glycosylated, and such is the case for NHE3. Please note that NHE3 gets phosphorylated and glycosylated (Uniprot ID P48764) and potentially, these modifications are adding ~10kDa extra to the predicted molecular weight. If you want to confirm it 100%, you could try de-glycosylating your protein and then performing a WB on it. 

Bioinformatics

• Gene Symbol: SLC9A3