Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

Western Blot: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-NNMT antibody. Corresponding NNMT RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Immunofluorescent staining of human cell line SiHa shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Nicotinamide N-Methyltransferase/NNMT Antibody [NBP2-32438] - Staining of human pancreas shows moderate to strong granular cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NNMT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nicotinamide N-Methyltransferase/NNMT Protein (NBP2-32438PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nicotinamide N-Methyltransferase/NNMT Antibody - BSA Free

• EC 2.1.1.1
• Nicotinamide NMethyltransferase
• Nicotinamide N-Methyltransferase
• NNMT

Background

N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. This gene encodes the protein responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NNMT