NOX1 Antibody - BSA Free

Western Blot: NOX1 Antibody [NBP1-69573] - NOX1 antibody - C-terminal region validated by WB using Epithelial Colorectal Adenocarcinoma CaCO2 at 1:10.

Western Blot: NOX1 Antibody [NBP1-69573] - This Anti-NOX1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.5ug/ml.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NOX1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NOX1(NADPH oxidase 1) The peptide sequence was selected from the C terminal of human NOX1. Peptide sequence STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Knockdown Validated
  • Western Blot 1.0 ug/ml
• Application Notes: Knockdown Validated and Use in and Immunocytochemistry/immunofluorescence and Immunohistochemistry-paraffin reported in scientific literature (PMID: 30096407). Use in ELISA reported in scientific literature (PMID: 30096407).
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27175607 and 23688500). Rat reactivity reported in scientific literature (PMID: 22683600).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NOX1 Antibody - BSA Free

• EC 1.6.3
• GP91-2
• Mitogenic oxidase 1
• MOX-1
• MOX1NADH/NADPH mitogenic oxidase subunit P65-MOX
• NADPH oxidase 1
• NADPH oxidase homolog-1
• NOH1
• NOH1mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating)
• NOH-1NADPH oxidase 1 variant NOH-1L
• NOX1
• NOX-1

Background

Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOX1 Antibody (NBP1-69573)(5)

Publications using NBP1-69573

• Alonso J, Canes L, Garcia-Redondo AB et al. The nuclear receptor NOR-1 modulates redox homeostasis in human vascular smooth muscle cells J. Mol. Cell. Cardiol. 2018-08-07 [PMID: 30096407] (IHC-P, ICC/IF, KD, Human)
• Perez-Ternero C, Rodriguez-Rodriguez R, Herrera M et al. Diet supplementation with rice bran enzymatic extract restores endothelial impairment and wall remodelling of ApoE(-/-) mice microvessels. Atherosclerosis. 2016-04-27 [PMID: 27175607] (WB, Mouse)
• He C, Zhu H, Zhang W et al. 7-Ketocholesterol Induces Autophagy in Vascular Smooth Muscle Cells through Nox4 and Atg4B. Am J Pathol 2013-06-12 [PMID: 23770348] (WB, Human)
• Zhang B1, Liu Z, Hu X. Zhang B, Liu Z, Hu X. Inhibiting cancer metastasis via targeting NAPDH oxidase 4. Biochem Pharmacol 2013-05-17 [PMID: 23688500] (WB, Mouse)
  
  Details:
  This publication used the HRP conjugated form of this antibody (NB110-58851H)
• Quintela AM, Jimenez R, Gomez-Guzman M et al. Activation of peroxisome proliferator-activated receptor-?/-? (PPAR?/?) prevents endothelial dysfunction in type 1 diabetic rats Free Radic Biol Med 2012-06-07 [PMID: 22683600] (WB, Rat)

Bioinformatics

• Gene Symbol: NOX1
• Entrez:
  • 27035(Human)
• Uniprot:
  • Q9Y5S8(Human)