NRAMP2/SLC11A2/DMT1 Antibody [mFluor Violet 450 SE]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: mFluor Violet 450 SE

NRAMP2/SLC11A2/DMT1 Antibody [mFluor Violet 450 SE] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human NRAMP2/SLC11A2/DMT1 (NP_001167597.1).
  
  Sequence:
  MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC11A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

mFluor(TM) is a trademark of AAT Bioquest, Inc. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody [mFluor Violet 450 SE]

• DCT1
• DCT1NRAMP 2
• Divalent cation transporter 1
• Divalent metal transporter 1
• DMT-1
• DMT1FLJ37416
• member 2
• NRAMP2
• NRAMP2natural resistance-associated macrophage protein 2
• SLC11A2
• solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP3-35108MFV450). (Showing 1 - 1 of 1 FAQ).

1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
   • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Bioinformatics

• Gene Symbol: SLC11A2