NTB-A/SLAMF6/CD352 Antibody - BSA Free

Western Blot: NTB-A/SLAMF6/CD352 Antibody [NBP2-49025] - Analysis in human cell line Daudi.

Immunohistochemistry-Paraffin: NTB-A/SLAMF6/CD352 Antibody [NBP2-49025] - Staining of human urinary bladder shows moderate membranous positivity in urothelial cells.

Immunohistochemistry-Paraffin: NTB-A/SLAMF6/CD352 Antibody [NBP2-49025] - Staining of human lymph node shows moderate membranous positivity in non-germinal center cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NTB-A/SLAMF6/CD352 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLAMF6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NTB-A/SLAMF6/CD352 Recombinant Protein Antigen (NBP2-49025PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NTB-A/SLAMF6/CD352 Antibody - BSA Free

• Activating NK receptor
• CD352 antigen
• CD352
• KALIFLJ50657
• Ly108
• NK-T-B-antigen
• NTBA receptor
• NTBA
• NTB-A
• NTB-AMGC104953
• NTBAT- and B-cell antigen
• SF2000
• SLAM family member 6
• SLAMF6

Background

NTBA (NK-, T-, and B-cell Antigen) is a 60 kD type I transmembrane glycoprotein. It is a member of Ig superfamily belonging to CD2/CD150 subfamily, also known as SLAMF6 (SLAM family member 6), LY108, TCOM, or SF2000. This antigen is expressed on NK cells, T cells (upregulated upon activation), and B cells. NTBA is its own ligand. The homophilic interaction of NTBA is involved in the induction of NK cytotoxicity, CD28 independent T cell costimulation, triggering Th1 cytokines production, and regulation of B cell tolerance. It may play a role in the regulation of autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLAMF6