O-GlcNAc Transferase p110 subunit Antibody - BSA Free

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-89845] - Analysis using Anti-OGT antibody NBP1-89845 (A) shows similar pattern to independent antibody NBP2-55252 (B).

Immunohistochemistry-Paraffin: O-GlcNAc Transferase p110 subunit Antibody [NBP1-89845] - Staining of human liver shows moderate nuclear and cytoplasmic positivity in hepatocytes.

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-89845] - Analysis in human cell line HeLa.

Western Blot: O-GlcNAc Transferase p110 subunit Antibody [NBP1-89845] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

O-GlcNAc Transferase p110 subunit Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OGT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  O-GlcNAc Transferase p110 subunit Recombinant Protein Antigen (NBP1-89845PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for O-GlcNAc Transferase p110 subunit Antibody - BSA Free

• EC 2.4.1
• EC 2.4.1.255
• FLJ23071
• HRNT1
• MGC22921
• O-GlcNAc transferase p110 subunit
• O-GlcNAc transferase subunit p110
• OGlcNAc Transferase
• O-GlcNAc Transferase
• O-GLCNAC
• OGT
• O-linked N-acetylglucosamine (GlcNAc) transferase(UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)
• O-linked N-acetylglucosamine transferase 110 kDa subunit
• UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDasubunit
• uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase

Background

Diffusion of metabolites and small non-nuclear molecules as well as active, mediated import of protein and export of protein and RNA through the nuclear envelope occurs through nuclear pore complexes or NPC's. NPC's contain up to 100 different polypeptides which have a combined mass of about 125 megadaltons. The channel available for passive transport through the NPC is about 9-10 nm in diameter while carrier mediated changes in the NPC result in a ~25 nm channel used for larger, actively transported molecules. Of the 100 polypeptides, at least 8 of these are O-linked N-acetylglycosamine-modified in mammalian cells. All of the mammalian O-linked glycoproteins contain multiple copies of phenylalanine, glycine dipeptide repeats dispersed throughout part of their sequence. Studies indicate that the NPC O-linked glycoproteins have a direct role in nuclear protein import.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OGT