Palladin Antibody - BSA Free

Western Blot: Palladin Antibody [NBP2-58731] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: Palladin Antibody [NBP2-58731] - Staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Palladin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVNNPELGLSRAALQMQFNAAERETNGVHPSRGVNGLINGKANSNKSLPTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PALLD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Palladin Recombinant Protein Antigen (NBP2-58731PEP)

Reactivity Notes

Mouse 83%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Palladin Antibody - BSA Free

• CGI151
• CGI-151
• FLJ22190
• FLJ38193
• KIAA0992FLJ39139
• MYN
• myoneurin
• Palladin
• palladin, cytoskeletal associated protein
• PALLD
• PNCA1
• Sarcoma antigen NY-SAR-77
• SIH002
• SIH002FLJ61376

Background

Palladin is a cytoskeletal protein required for organization of normal actin cytoskeleton. Palladin plays roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. Palladin may function as a scaffolding molecule with the potential to impact both actin polymerization and the assembly of existing actin filaments into higher-order arrays. It binds to proteins that bind to either monomeric or filamentous actin. It localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Palladin's different isoforms may have functional differences. Palladin is also involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PALLD