PAWR / PAR4 Recombinant Protein Antigen

Images

 
There are currently no images for PAWR / PAR4 Protein (NBP1-87338PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PAWR / PAR4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAWR.

Source: E. coli

Amino Acid Sequence: LQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGTLVSSSTLEKKIEDLEKEVVRERQENLRLVRLMQDKEEMIGKLKEEIDLLNRDLDDIEDENEQLKQENKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAWR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87338.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAWR / PAR4 Recombinant Protein Antigen

  • Par-4
  • PAR4prostate apoptosis response protein 4
  • PRKC apoptosis WT1 regulator protein
  • PRKC, apoptosis, WT1, regulator
  • Prostate apoptosis response 4 protein
  • prostate apoptosis response protein PAR-4
  • transcriptional repressor PAR4
  • WT1-interacting protein

Background

The tumor suppressor WT1 represses and activates transcription. The protein encoded by this gene is a WT1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger DNA binding domain of WT1. This protein is specifically upregulated during apoptosis of prostate cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NLS261
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
NBP1-78028
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-16555
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
H00055065-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88861
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
NBP1-87338PEP
Species: Hu
Applications: AC

Publications for PAWR / PAR4 Protein (NBP1-87338PEP) (0)

There are no publications for PAWR / PAR4 Protein (NBP1-87338PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAWR / PAR4 Protein (NBP1-87338PEP) (0)

There are no reviews for PAWR / PAR4 Protein (NBP1-87338PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAWR / PAR4 Protein (NBP1-87338PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAWR / PAR4 Products

Research Areas for PAWR / PAR4 Protein (NBP1-87338PEP)

Find related products by research area.

Blogs on PAWR / PAR4

There are no specific blogs for PAWR / PAR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PAWR / PAR4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PAWR