Pax3 Antibody - BSA Free

Western Blot: Pax3 Antibody [NBP3-10955] - WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: Human Lung

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Pax3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Pax3 (NP_852122). Peptide sequence GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAX3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Western Blot
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Pax3 Antibody - BSA Free

• CDHS
• HUP2
• HUP2MGC120384
• MGC120381
• MGC120382
• MGC120383
• MGC134778
• paired box 3
• paired box gene 3 (Waardenburg syndrome 1)
• paired box homeotic gene 3
• paired box protein Pax-3
• paired domain gene 3
• paired domain gene HuP2
• Pax3
• Waardenburg syndrome 1
• WS1
• WS3

Background

PAX3 is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These proteins play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAX3