Periostin/OSF-2 Antibody - BSA Free

Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472] - Staining in human skin and pancreas tissues using anti-POSTN antibody. Corresponding POSTN RNA-seq data are presented for the same tissues.

Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: Periostin/OSF-2 Antibody [NBP1-82472] - Staining of human skin shows high expression.

Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - Characteristics of lung cancer cell lines according to Periostin/OSF-2 (POSTN) expression. Comparison of Periostin/OSF-2 expression levels detected by Western blot. Image collected and cropped by CiteAb from the following publication (//www.mdpi.com/1422-0067/23/3/1240) licensed under a CC-BY license.

Immunohistochemistry: Periostin/OSF-2 Antibody [NBP1-82472] - Section of non-small cell lung carcinoma (NSCLC) immunostained for Periostin/OSF-2 in cancer-associated fibroblasts (CAFs). Magnification 50×. Bar = 200 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32987711/), licensed under a CC-BY license.

Serial sections of non-small cell lung carcinoma (NSCLC) immunostained for (A) periostin (POSTN), (B) alpha -smooth muscle actin ( alpha -SMA), (C) podoplanin (D2-40), and (D) vimentin in cancer-associated fibroblasts (CAFs). Magnification 50×. Bar = 200 µm.

Western Blot: Periostin/OSF-2 Antibody [NBP1-82472] - The efficacy of shRNA lentiviral particles transfection. (A) Silencing of periostin (POSTN) expression was confirmed by Western blot analysis. beta -actin was used as an internal control. (B) Confocal images & fluorescence analysis showing the expression of POSTN in control A549.CTRL cells & A549.shRNA cells (*** p 0.05). Objective 60×/1.40 Oil; pinhole airy 1.25. Bar = 20 µm. (C) Immunohistochemical expression level of periostin (POSTN) in the tissue of particular non-small cell lung carcinoma (NSCLC) subtypes: squamous cell carcinoma (SCC) & adenocarcinoma (AC) (p > 0.05). IRS, immunoreactive score. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/35163164), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Ca, Mu, Rt
• Applications: WB, IHC, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Periostin/OSF-2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POSTN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC-P, Retrieval method: HIER pH6.
• Control Peptide:

  Periostin/OSF-2 Protein (NBP1-82472PEP)

Reactivity Notes

Use in Canine reported in scientific literature (PMID: 32354887).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Periostin/OSF-2 Antibody - BSA Free

• Fasciclin I-like
• MGC119510
• MGC119511
• OSF2
• OSF-2
• OSF-2osteoblast specific factor 2 (fasciclin I-like)
• OSF2periodontal ligament-specific periostin
• Osteoblast-specific factor 2
• PDLPOSTN
• periostin isoform thy2
• periostin isoform thy4
• periostin isoform thy6
• periostin isoform thy8
• Periostin
• periostin, osteoblast specific factor
• PNRP11-412K4.1
• POSTN
• TRIF52

Background

Periostin is a disulfide linked 90 kDa 811 amno acid protein originally isolated as a osteoblastspecific factor that functions as a cell adhesion molecule for preosteoblasts and is thought to be involved in osteoblast recruitment, attachment and spreading. Additionally, periostin expression has previously been shown to be significantly increased by both transforming growth factor beta-1(TGFbeta1) and bone morphogenetic protein (BMP)-2. OSF-2 has a typical signal sequence, followed by a cysteine-rich domain, a fourfold repeated domain and a C-terminal domain. The fourfold repeated domain of OSF-2 shows homology with the insect protein fasciclin. Periostin mRNA is expressed in the developing mouse embryonic and fetal heart, and that it is localized to the endocardial cushions that ultimately divide the primitive heart tube into a four-chambered heart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Periostin/OSF-2 Antibody (NBP1-82472)(7)

Publications using NBP1-82472

• Eleonora Brambilla, Rafał Ciaputa, Paola Crepaldi, Stanislaw Dzimira, Marcin Nowak, Piotr Dziegiel, Aleksandra Piotrowska, Veronica Mollica Govoni, Carlos Eduardo Fonseca-Alves, Renée Laufer-Amorim, Damiano Stefanello, Stefano Romussi, Valeria Grieco Canine urothelial carcinoma: expression of Periostin in spontaneous canine urothelial carcinoma and its correlation with histological features Frontiers in Veterinary Science 2023-11-16 [PMID: 38076555]
• Ratajczak-Wielgomas K, Kmiecik A, Dziegiel P Role of Periostin Expression in Non-Small Cell Lung Cancer: Periostin Silencing Inhibits the Migration and Invasion of Lung Cancer Cells via Regulation of MMP-2 Expression International Journal of Molecular Sciences 2022-01-22 [PMID: 35163164] (IF/IHC, WB)
• Ratajczak-Wielgomas, K, Kmiecik, A Et al. Prognostic Significance of Stromal Periostin Expression in Non-Small Cell Lung Cancer. Int J Mol Sci 2020-09-24 [PMID: 32987711] (IF/IHC, Mouse)
• Borecka P, Ratajczak-Wielgomas K, Ciaputa R et al. Expression of Periostin in Cancer-associated Fibroblasts in Mammary Cancer in Female Dogs In Vivo 2020-12-31 [PMID: 32354887] (IHC-P, Canine)
• Alexandre Calon, Enza Lonardo, Antonio Berenguer-Llergo et al. Stromal gene expression defines poor-prognosis subtypes in colorectal cancer. Nature Genetics 2015-02-23 [PMID: 25706628] (IF/IHC, Human)
• Gbormittah FO, Haab BB, Partyka K et al. Characterization of glycoproteins in pancreatic cyst fluid using a high-performance multiple lectin affinity chromatography platform. J Proteome Res 2014-01-03 [PMID: 24303806] (WB, Human)
• Edlund K, Lindskog C, Saito A et al. CD99 is a novel prognostic stromal marker in non-small cell lung cancer. Int J Cancer 2012-11-15 [PMID: 22392539]

Bioinformatics

• Gene Symbol: POSTN
• Entrez:
  • 10631(Human)
  • 50706(Mouse)
• Uniprot:
  • Q15063()