Phospholipase C beta 2 Antibody - BSA Free

Staining of human skeletal muscle shows low expression as expected.

Staining of human bone marrow shows high expression.

Analysis in human bone marrow and skeletal muscle tissues using Anti-PLCB2 antibody. Corresponding PLCB2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Phospholipase C beta 2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PINALNSGYHHLCLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGLPEKPFPLASPVASQVN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PLCB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Phospholipase C beta 2 Antibody - BSA Free

• EC 3.1.4.11
• FLJ38135
• Phosphoinositide phospholipase C-beta-2,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2
• Phospholipase C beta 2
• phospholipase C, beta 2
• Phospholipase C-beta-2
• PLCB2
• PLC-beta-2

Background

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLCB2