Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - 1. Human Skin Fibroblasts (100ug) 2. HepG2 cells (20 ug) 3. HEK273 cells (20 ug) 4. HeLa skin cells(20 ug) 5. Hamster CHO K1 cells (20 ug) Primary Dilution: 1 : 5000 Secondary Antibody: Clean-Blot IP detection Reagent and Kit Secondary Dilution: 1 : 2000.

Immunohistochemistry-Paraffin: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Western Blot: Phosphoribosyl Pyrophosphate Amidotransferase Antibody [NBP1-52964] - HepG2 Cell Lysate, concentration 0.25ug/ml.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to PPAT(phosphoribosyl pyrophosphate amidotransferase) The peptide sequence was selected from the N terminal of PPAT. Peptide sequence VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPAT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Phosphoribosyl Pyrophosphate Amidotransferase Antibody - BSA Free

• ATASE
• EC 2.4.2.14
• glutamine phosphoribosylpyrophosphatate amidotransferase
• Glutamine phosphoribosylpyrophosphate amidotransferase
• glutamine PRPP amidotransferase
• GPATamidophosphoribosyltransferase
• phosphoribosyl pyrophosphate amidotransferase
• PRAT

Background

PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. This gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPAT
• Uniprot:
  • Q06203(Human)