![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining in human stomach and liver tissues using NBP2-39021 antibody. Corresponding GALNT7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0016.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining in human stomach and liver tissues using NBP2-39021 antibody. Corresponding GALNT7 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GALNT7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Publication using NBP2-39021 | Applications | Species |
|---|---|---|
| McCall JL, Varney ME, Rice E et al. Prenatal Cadmium Exposure Alters Proliferation in Mouse CD4+ T Cells via LncRNA Snhg7 Frontiers in immunology 2022-01-11 [PMID: 35087510] (WB, Mouse) | WB | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney, liver, prostate and stomach using Anti-GALNT7 antibody NBP2-39021 (A) shows similar protein distribution across tissues to independent antibody NBP2-39054 (B).](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0012.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney, liver, prostate and stomach using Anti-GALNT7 antibody NBP2-39021 (A) shows similar protein distribution across tissues to independent antibody NBP2-39054 (B).")
![Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Western-Blot-NBP2-39021-img0002.jpg "Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4")
![Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human cell line HaCaT shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39021-img0003.jpg "Immunocytochemistry/Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human cell line HaCaT shows localization to the Golgi apparatus. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney shows very weak positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0011.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney shows very weak positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0013.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human prostate shows strong positivity in glandular cells of Golgi apparatus.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0014.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human prostate shows strong positivity in glandular cells of Golgi apparatus.")
![Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.](http://images.novusbio.com/fullsize/Polypeptide-GalNac-Transferase-7-GALNT7-Antibody-Immunohistochemistry-Paraffin-NBP2-39021-img0015.jpg "Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.")
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity Nephronectin [Unconjugated]](https://images.novusbio.com/images2/Nephronectin_4298NP_2291.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")