Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKINELTGIKESDTGLAPPALWDLAA |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | PSMC2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Proteasome 19S S7 antibody validated for Simple Western from a verified customer review. See Simple Western Antibody Database for Simple Western validation: Tested in Mouse whole-spleen lysates, separated by Size, antibody dilution of 1:25 |
||
Control Peptide |
|
||
Reviewed Applications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
![]() Enlarge |
reviewed by:
Verified Customer |
Simple Western | Mouse | 08/23/2019 |
Summary
|
||||||||
reviewed by:
Verified Customer |
WB | Human | 08/20/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Proteasome 19S S7 Antibody (NBP1-87797)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 08/23/2019 |
||
Application: | Simple Western | |
Species: | Mouse |
Verified Customer 08/20/2015 |
||
Application: | WB | |
Species: | Human |
Gene Symbol | PSMC2 |