PTTG1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PTTG1/2/3 Antibody [NBP2-46709] - Staining of human cell line PC-3 shows localization to nucleoli & cytosol.

Immunohistochemistry-Paraffin: PTTG1 Antibody [NBP2-46709] - PTTG1/2/3 Antibody [NBP2-46709] - Staining of human testis shows strong cytoplasmic positivity in a subset of seminiferus ducts.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PTTG1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTVKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PTTG1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Securin Recombinant Protein Antigen (NBP2-46709PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PTTG1 Antibody - BSA Free

• EAP1MGC126883
• ESP1-associated protein 1
• Esp1-associated protein
• hPTTG
• pituitary tumor-transforming 1
• Pituitary tumor-transforming gene 1 protein
• PTTGMGC138276
• securin
• Tumor-transforming protein 1
• TUTR1HPTTG

Background

The product of the oncogene PTTG, pituitary tumor transforming gene, is a human homolog of the anaphase-inhibitor vertebrate protein, securin. PTTG is a 22 kDa protein that contains a basic amino-terminal domain and an acidic carboxy-terminal domain, which acts as a transactivation domain when fused to a heterologous DNA binding domain. Human PTTG is overexpressed in Jurkat and is also detected in human thymus, testis, and placenta. PTTG is mainly expressed in the cytoplasm and is also partially localized to the nucleus. Vertebrate PTTG regulates the separin Esp1, which promotes chromatid separation, to overcome the cohesive forces that hold sister chromatids together. This regulatory function of PTTG suggests that defective regulation of cohesion may contribute to cancer by promoting chromosome instability. Although vertebrate PTTG shares cell-cycle functions with its yeast securin counterparts Pds1p and Cut2, none share sequence homology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PTTG1
• Entrez:
  • 9232(Human)
• Uniprot:
  • O95997(Human)