Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody [NBP1-85955] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PDK1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot Reported in scientifc literature (PMID: 30092282)
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Theoretical MW: 49 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Pyruvate Dehydrogenase Kinase 1/PDK1 Recombinant Protein Antigen (NBP1-85955PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody - BSA Free

• EC 2.7.11
• EC 2.7.11.2
• mitochondrial pyruvate dehydrogenase, lipoamide, kinase isoenzyme 1
• PDH kinase 1
• PDK1
• PDK-1
• PKB kinase
• Pyruvate dehydrogenase kinase isoform 1
• pyruvate dehydrogenase kinase, isoenzyme 1
• pyruvate dehydrogenase kinase, isozyme 1
• Pyruvate dehydrogenase lipoamide kinase isozyme 1, mitochondrial

Background

Pyruvate dehydrogenase kinase isoform 1 (PDK1) is a component of the mitochondrial multienzyme complex (PHD) which is responsible for carbohydrate fuel regulation. PDK1 inhbits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.
PDK1 antibodies are useful tools for glucose metabolism research and mitochondrial metabolism studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Pyruvate Dehydrogenase Kinase 1/PDK1 Antibody (NBP1-85955)(3)

Publications using NBP1-85955

• Huang B, Ren J, Ma Q et Al. A novel peptide PDHK1-241aa encoded by circPDHK1 promotes ccRCC progression via interacting with PPP1CA to inhibit AKT dephosphorylation and activate the AKT-mTOR signaling pathway Mol Cancer 2024-02-15 [PMID: 38360682]
• Pan H, Strickland A, Madhu V et al. RNA binding protein HuR regulates extracellular matrix gene expression and pH homeostasis independent of controlling HIF-1a signaling in nucleus pulposus cells Matrix Biol. 2018-08-06 [PMID: 30092282] (WB)
• Fack F, Espedal H, Keunen O et al. Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas. Acta Neuropathol 2015-01-01 [PMID: 25322816] (WB, Human)

Bioinformatics

• Gene Symbol: PDK1
• Uniprot:
  • Q15118(Human)