RIN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: RIN1 Antibody [NBP1-85905] - Staining of human pancreas shows moderate cytoplasmic positivity in islet cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

RIN1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RIN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  RIN1 Protein (NBP1-85905PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for RIN1 Antibody - BSA Free

• Ras and Rab interactor 1
• ras inhibitor 1
• Ras inhibitor JC99
• ras inhibitor RIN1
• Ras interaction/interference protein 1

Background

Ras effector protein, which may serve as an inhibitory modulator of neuronal plasticity in aversive memory formation. Can affect Ras signaling at different levels. First, by competing with RAF1 protein for binding to activated Ras. Second, by enhancing signaling from ABL1 and ABL2, which regulate cytoskeletal remodeling. Third, by activating RAB5A, possibly by functioning as a guanine nucleotide exchange factor (GEF) for RAB5A, by exchanging bound GDP for free GTP, and facilitating Ras-activated receptor endocytosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for RIN1 Antibody (NBP1-85905)(1)

Publication using NBP1-85905

• Balaji K, French CT, Miller JF, Colicelli J. The RAB5-GEF Function of RIN1 Regulates Multiple Steps During Listeria monocytogenes Infection. Traffic 2014-11-01 [PMID: 25082076] (ICC/IF)

Bioinformatics

• Gene Symbol: RIN1