RNA polymerase I termination factor Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

RNA polymerase I termination factor Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TTF1.
  
  

  Source: E. coli

  Amino Acid Sequence: VKRARVSGDDFSVPSKNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPANEEHNVETAEDSEIRYLSADSGDADDSDADLGSAV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TTF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38740.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RNA polymerase I termination factor Recombinant Protein Antigen

• RNA polymerase I termination factor
• transcription termination factor 1
• Transcription termination factor I
• transcription termination factor, RNA polymerase I
• TTF-1
• TTF-I

Background

The TTF1 gene encodes a 905 amino acid long, 103 kDA transcription termination factor 1 protein, also known as a RNA polymerase I termination factor, which functions in terminating ribosomal gene transcription. Additionally, it regulates fork arrest replication and RNA polymerase I transcription on chromatin. Through monitoring the activation as well as the silencing of rDNA transcription, TTF1 acts in rDNA regulation. TTF1 functions in RNA polymerase I transcription as well as mitochondrial transcription and gene expression. It is known to interact with genes PTRF, NFATC3, BAZ2A, SMAD1, and SMAD7. TTF1 has been researched regarding its role in lung cancer, small cell carcinoma, sex cord-gonadal stromal tumor, thyroiditis, blastoma, adenocarcinoma, desmoplastic small round cell tumors, and hirschsprung's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TTF1