SCAP Antibody - BSA Free

Immunohistochemistry-Paraffin: SCAP Antibody [NBP1-89624] - Staining of human Stomach shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SCAP Antibody [NBP1-89624] - Staining of human Adrenal gland shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SCAP Antibody [NBP1-89624] - Staining of human Pancreas shows strong granular cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: SCAP Antibody [NBP1-89624] - Staining of human Testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SCAP Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVWDAIEGVLCCSSEEVSSGITALVFLDKRIVAARLNGSLDFFSLETHTALSPLQFRGTPGRGSSPASPVYSSSDTVACHLTHTVPCAHQKPITALKAAAGRLVTGSQDHTLRVFRLED
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCAP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SCAP Recombinant Protein Antigen (NBP1-89624PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCAP Antibody - BSA Free

• KIAA0199
• PSEC0227
• SREBF chaperone
• SREBP cleavage-activating protein
• sterol regulatory element binding protein cleavage-activating protein

Background

Sterol regulatory element binding protein (SREBP) cleavage-activating protein (SCAP) is a molecular chaperone that plays a role in the biosynthesis of cholesterol and triglycerides (1). SCAP is a membrane protein that helps shuttle SREBP from the endoplasmic reticulum (ER) via coat protein II (COPII) vesicles to the golgi where SREBP is cleaved via protease S1P and S2P, becomes activated, and is translocated to the nucleus for transcription (1-3). The SCAP protein has a theoretical molecular weight of 140 kDa and is comprised of 1276 amino acids with an N-terminal domain containing 8 transmembrane alpha helices, where transmembrane 2-6 consist of a sterol-sensing domain, and a C-terminal domain with WD40 motif repeats (1,3). The SCAP-SREBP association plays a pivotal role in regulating lipid metabolism and lipogenesis (1,4). SREBP activation via SCAP is associated with accumulation of triglycerides and cholesterol leading to metabolic disorders including diabetes, atherosclerosis, and nonalcoholic fatty liver disease (NAFLD) (1,4). Animal models have revealed that inhibition or blocking of SCAP using antagonists may be a potential therapeutic target for hyperlipidemia and hypertriglyceridemia (1,4).

References

1. Lee, S. H., Lee, J. H., & Im, S. S. (2020). The cellular function of SCAP in metabolic signaling. Experimental & molecular medicine, 52(5), 724-729. https://doi.org/10.1038/s12276-020-0430-0

2. Cheng, X., Li, J., & Guo, D. (2018). SCAP/SREBPs are Central Players in Lipid Metabolism and Novel Metabolic Targets in Cancer Therapy. Current topics in medicinal chemistry, 18(6), 484-493. https://doi.org/10.2174/1568026618666180523104541

3. Brown, M. S., Radhakrishnan, A., & Goldstein, J. L. (2018). Retrospective on Cholesterol Homeostasis: The Central Role of Scap. Annual review of biochemistry, 87, 783-807. https://doi.org/10.1146/annurev-biochem-062917-011852

4. Moon Y. A. (2017). The SCAP/SREBP Pathway: A Mediator of Hepatic Steatosis. Endocrinology and metabolism (Seoul, Korea), 32(1), 6-10. https://doi.org/10.3803/EnM.2017.32.1.6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCAP