Serine Palmitoyltransferase 2 Antibody

Staining of human cell line RT-4 shows localization to plasma membrane & cell junctions.

Lane 1: Marker [kDa] 250,130,95,72,55,36,28,17,10Lane 2: RT-4Lane 3: U-251MGLane 4: Human PlasmaLane 5: LiverLane 6: Tonsil

Product Discontinued

Serine Palmitoyltransferase 2 Antibody Summary

• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Serine Palmitoyltransferase 2 using the following amino acid sequence: NYLGFARNTGSCQEAAAKVLEEYGAGVCSTRQEIGNLDKHEELEELVARFL
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPTLC2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 µg/ml
  • Western Blot 0.04-0.4 µg/ml
• Application Notes: For ICC/IF, we recommend using a combination of PFA and Triton X-100. This will give you the optimal results for your experiments.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Serine Palmitoyltransferase 2 Antibody

• EC 2.3.1
• EC 2.3.1.50
• KIAA0526
• KIAA0526HSN1C
• LCB 2
• LCB2
• LCB2a
• LCB2NSAN1C
• Long chain base biosynthesis protein 2
• Long chain base biosynthesis protein 2a
• Serine Palmitoyltransferase 2
• serine palmitoyltransferase, long chain base subunit 2
• serine palmitoyltransferase, subunit II
• Serine-palmitoyl-CoA transferase 2
• SPT 2
• SPT2
• SPTLC2

Background

SPTLC2 - serine palmitoyltransferase, long chain base subunit 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPTLC2