Sirtuin 2/SIRT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane and cytosol. Antibody stainign is shown in green.

Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cerebellum shows moderate cytoplasmic positivity in oligodendrocytes.

Immunohistochemistry-Paraffin: Sirtuin 2/SIRT2 Antibody [NBP1-87039] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in oligodendrocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Sirtuin 2/SIRT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL
• Marker: Early Oligodendrocyte Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SIRT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. WB reported in scientific literature (PMID: 24469059).
• Control Peptide:

  Sirtuin 2/SIRT2 Protein (NBP1-87039PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%). Human reactivity reported in scientific literature (PMID: 24469059).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Sirtuin 2/SIRT2 Antibody - BSA Free

• EC 3.5.1
• EC 3.5.1.-
• FLJ35621
• FLJ37491
• S.cerevisiae, homolog) 2
• SIR2L2
• SIRT2
• Sirtuin 2
• sirtuin type 2

Background

Silent information regulator 2 (Sir2) family of enzymes has been implicated in many cellular processes that include histone deacetylation, gene silencing, chromosomal stability, and aging. O-acetyl-ADP-ribose causes a delay/block in oocyte maturation and results in a delay/block in embryo cell division in blastomeres. It has been demonstrated that the production of O-acetyl-ADP-ribose is evolutionarily conserved among Sir2-like enzymes from yeast, Drosophila, and human. Also, endogenous yeast Sir2 complex from telomeres was shown to generate O-acetyl-ADP-ribose (1). SIRT2 is a predominantly cytoplasmic protein that colocalizes with microtubules. SIRT2 deacetylates lysine-40 of alpha-tubulin both in vitro and in vivo. Knockdown of SIRT2 via siRNA results in tubulin hyperacetylation. SIRT2 colocalizes and interacts in vivo with HDAC6, another tubulin deacetylase (2). Cytoskeleton-related protein, SIRT2 is down-regulated in gliomas, and data suggests that ectopic expression of SIRT2 in glioma cell lines led to the perturbation of the microtubule network (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sirtuin 2/SIRT2 Antibody (NBP1-87039)(1)

Publication using NBP1-87039

• P K Bajpe, A Prahallad, H Horlings et al. A chromatin modifier genetic screen identifies SIRT2 as a modulator of response to targeted therapies through the regulation of MEK kinase activity. Oncogene 2014-01-27 [PMID: 24469059] (WB, Human)

Bioinformatics

• Gene Symbol: SIRT2