SLC34A2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SLC34A2 Antibody [NBP3-17541] - Staining of human cell line RPTEC TERT1 shows localization to plasma membrane & vesicles.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SLC34A2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: APWPELGDAQPNPDKYLEGAAGQQPTAPDKSKETNKNNTEAPVTKIELLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC34A2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, pH 7.2, 40% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC34A2 Antibody - BSA Free

• NAPI-3B
• NPTIIb
• sodium/phosphate cotransporter 2B
• solute carrier family 34 (sodium phosphate), member 2
• type II sodium-dependent phosphate transporter 3b

Background

SLC34A2 may be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. Mayhave a role in the synthesis of surfactant in lungs' alveoli

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC34A2