Smad4 Antibody (6B4D6)

Western Blot: Smad4 Antibody (1H7D3) [NBP3-15673] - Western blot analysis of extracts from normal (control) and Smad4 knockout (KO) 293T cells, using Smad4 antibody (NBP3-15673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Western Blot: Smad4 Antibody (1H7D3) [NBP3-15673] -Analysis of various lysates using [KO Validated] Smad4 Rabbit mAb at 1:1000 dilution incubated overnight at 4c.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 3s.

Western Blot: Smad4 Antibody (6B4D6) [Smad4] - Western blot analysis of various lysates using [KO Validated] Smad4 Rabbit mAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

Immunohistochemistry-Paraffin: Smad4 Antibody (1H7D3) [NBP3-15673] - Analysis of paraffin-embedded Human placenta tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Chromatin Immunoprecipitation: Smad4 Antibody (6B4D6) [Smad4] - Chromatin immunoprecipitation analysis of extracts of HepG2 cells, using [KO Validated] Smad4 Rabbit mAb and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Smad4 Antibody (6B4D6) [Smad4] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using [KO Validated] Smad4 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC, IP, ChIP, KO
• Clone: 6B4D6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Smad4 Antibody (6B4D6) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 320-552 of human Smad4 (NP_005350.1). PEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQPLD
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SMAD4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP) 5ug antibody for 10μg-15μg of Chromatin
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:500 - 1:2000
  • Immunohistochemistry-Paraffin 1:500 - 1:2000
  • Immunoprecipitation 0.5ug-4ug antibody for 200μg-400μg extracts of whole cells
  • Knockout Validated
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Smad4 Antibody (6B4D6)

• DPC4
• DPC4SMAD, mothers against DPP homolog 4 (Drosophila)
• hSMAD4
• JIP
• MAD homolog 4
• MADH4
• MADH4mothers against decapentaplegic homolog 4
• mothers against decapentaplegic homolog 4
• mothers against decapentaplegic, Drosophila, homolog of, 4
• SMAD 4
• SMAD family member 4MAD, mothers against decapentaplegic homolog 4 (Drosophila)
• SMAD, mothers against DPP homolog 4
• Smad4

Background

Smad proteins, the mammalian homologs of the Drosophila Mothers against dpp (Mad) have been implicated as downstream effectors of TGFbeta/BMP signaling. Smad1 (also designated Madr1 or JV4-1), Smad5 and mammalian Smad8 (also designated Smad9 or MadH6) are effectors of BMP2 and BMP4 function while Smad2 (also designated Madr2 or JV18-1) and Smad3 are involved in TGFbeta and activin-mediated growth modulation. Smad4 (also designated DPC4) has been shown to mediate all of the above activities through interaction with various Smad family members. Smad6 and Smad7 regulate the response to activin/TGFbeta signaling by interfering with TGFbeta-mediated phosphorylation of other Smad family members.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: SMAD4