Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

Western Blot: Sodium Potassium ATPase Alpha 4 Antibody [NBP2-94614] - Analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1S.

Western Blot: Sodium Potassium ATPase Alpha 4 Antibody [NBP2-94614] - Analysis of extracts of various cell lines, using Sodium Potassium ATPase Alpha 4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1S.

• Reactivity: Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ATP1A4 (NP_653300.2). MGLWGKKGTVAPHDQSPRRRPKKGLIKKKMVKREKQKRNMEELKKEVVMDDHKLTLEELSTKYSVDLTKGHSHQRAKEILTRGGPNTVTP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP1A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Sodium Potassium ATPase Alpha 4 Antibody - Azide and BSA Free

• ATP1A1
• ATP1A4
• ATP1AL2
• ATP1AL2Na+/K+ ATPase, alpha-D polypeptide
• ATPase, Na+/K+ transporting, alpha 4 polypeptide
• ATPase, Na+/K+ transporting, alpha polypeptide-like 2
• EC 3.6.3
• EC 3.6.3.9
• K-ATPase subunit alpha-C
• MGC25056
• Na
• Na(+)/K(+) ATPase alpha-4 subunit
• Na+/K+ ATPase 4
• Sodium Potassium ATPase Alpha 4
• sodium pump 4
• Sodium pump subunit alpha-4
• sodium/potassium-transporting ATPase alpha-4 chain
• sodium/potassium-transporting ATPase subunit alpha-4

Background

The protein encoded by the Sodium Potassium ATPase Alpha 4 gene belongs to the family of P-type cation transport ATPases, and to the subfamily ofNa+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining theelectrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential forosmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electricalexcitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and asmaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This geneencodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have beenidentified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ATP1A4