Sonic Hedgehog/Shh Antibody - BSA Free

Western Blot: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Lane A: Marker; Lane B HepG2 Cell Lysate. Antibody titration 1.0ug/ml. Gel concentration 12%

Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Chicken embryos Primary Antibody: 1 : 1000 (NBP1-69270) anti -shh Secondary Antibody: 1 : 500 goat anti-rabbit HRP conjugated.

Immunohistochemistry-Paraffin: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human Intestine cells with positive label: Epithelial cells of intestinal villus (indicated with arrows). Concentration 4.0-8.0 ug/ml

Immunohistochemistry: Sonic Hedgehog/Shh Antibody [NBP1-69270] - Human glioma cells. Primary Antibody Dilution :1:200 Secondary Antibody :Anti-rabbit-GFP. Secondary Antibody Dilution :1:500. Color/Signal Descriptions :1. SHH: Green 2. DAPI: Blue 3. Merge. Gene Name :SHH

• Reactivity: Hu, Mu, Ch
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Sonic Hedgehog/Shh Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SHH, sonic hedgehog homolog (Drosophila). The peptide sequence was selected from the N-terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SHH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Sonic Hedgehog/Shh Antibody - BSA Free

• HHG1
• HHG-1
• HLP3
• HPE3
• MCOPCB5
• MCOPCB5sonic hedgehog (Drosophila) homolog
• Shh
• ShhNC
• SMMCI
• SMMCIsonic hedgehog homolog (Drosophila)
• sonic hedgehog homolog
• sonic hedgehog protein
• Sonic Hedgehog
• TPT
• TPTPS

Background

SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.This gene, which is expressed only during embryogenesis, encodes a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Of three human proteins showing sequence and functional similarity to the sonic hedgehog protein of Drosophila, this protein is the most similar. The protein is made as a precursor that is autocatalytically cleaved; the N-terminal portion is soluble and contains the signalling activity while the C-terminal portion is involved in precursor processing. More importantly, the C-terminal product covalently attaches a cholesterol moiety to the N-terminal product, restricting the N-terminal product to the cell surface and preventing it from freely diffusing throughout the developing embryo. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE), a disorder in which the developing forebrain fails to correctly separate into right and left hemispheres. HPE is manifested by facial deformities. In addition, it is thought that mutations in this gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Sonic Hedgehog/Shh Antibody (NBP1-69270)(2)

Publications using NBP1-69270

• Lozito TP, Londono R, Sun AX, Hudnall ML Introducing dorsoventral patterning in adult regenerating lizard tails with gene-edited embryonic neural stem cells Nature communications 2021-10-14 [PMID: 34650077] (IF/IHC)
• Lozito TP, Tuan RS. Lizard tail skeletal regeneration combines aspects of fracture healing and blastema-based regeneration Development 2016-07-07 [PMID: 27387871]

FAQs for Sonic Hedgehog/Shh Antibody (NBP1-69270). (Showing 1 - 1 of 1 FAQs).

1. I am interested in using your sonic hedgehog antibody on paraffin-sections of mouse tissue. Do you have a protocol and references for this? Do you offer a sample size product to try?
   • In regards to your inquiry about the Sonic Hedgehog antibody and its use in IHC-P for mouse samples. Unfortunately we do not have any specific reference yet reported for this one to provide. Here is a link to our lab's recommended Immunohistochemistry-Paraffin Protocol. We only have the one size available so there is no sample size associated with this antibody.

Bioinformatics

• Gene Symbol: SHH
• Entrez:
  • 6469(Human)
• Uniprot:
  • Q15465()