SOX6 Antibody - BSA Free

Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining in human testis and endometrium tissues using anti-SOX6 antibody. Corresponding SOX6 RNA-seq data are presented for the same tissues.

Western Blot: SOX6 Antibody [NBP1-86149] - Analysis in control (vector only transfected HEK293T lysate) and SOX6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SOX6 Antibody [NBP1-86149] - Staining of human testis shows high expression.

Staining of human cerebral cortex shows moderate nuclear positivity in neurons.

Staining of human testis shows strong nuclear positivity in spermatids.

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Immunohistochemistry analysis in human testis and endometrium tissues using HPA003908 antibody. Corresponding SOX6 RNA-seq data are presented for the same tissues.

Staining of human endometrium shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOX6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQ
• Predicted Species: Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOX6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SOX6 Protein (NBP1-86149PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22361696)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SOX6 Antibody - BSA Free

• HSSOX6
• SOX6
• SOXD
• SRY (sex determining region Y)-box 6
• SRY-box containing gene 6
• transcription factor SOX-6

Background

Sox genes comprise a family of genes that are related to the mammalian sex determining gene SRY. These genes similarly contain sequences that encode for the HMG-box domain, which is responsible for the sequence-specific DNA-binding activity. Sox genes encode putative transcriptional regulators implicated in the decision of cell fates during development and the control of diverse developmental processes. The highly complex group of Sox genes cluster at a minimum of 40 different loci that rapidly diverged in various animal lineages. At present 30 Sox genes have been identified, and members of this family have been shown to be conserved during evolution and to play key roles during animal development. Some are involved in human diseases, including sex reversal.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOX6 Antibody (NBP1-86149)(2)

Publications using NBP1-86149

• Yeung F, Chung E, Guess MG et al. Myh7b/miR-499 gene expression is transcriptionally regulated by MRFs and Eos. Nucleic Acids Res 2012-08-01 [PMID: 22638570]
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]

Bioinformatics

• Gene Symbol: SOX6