SOX9 Antibody - BSA Free

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining in human testis and skeletal muscle tissues . Corresponding SOX9 RNA-seq data are presented for the same tissues.

Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-SOX9 antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.

Immunocytochemistry/Immunofluorescence: SOX9 Antibody [NBP1-85551] - Further analysis of P2X7-EGFP expressing cells in the dentate gyrus and CA1 region. Co-staining of EGFP with the alternative astrocyte marker SOX9 in the CA1 region. Scale bar: 50 um. DAPI staining in blue (n = at least three animals in all experiments). Image collected and cropped by CiteAb from the following publication (//elifesciences.org/articles/36217), licensed under a CC-BY license.

Western Blot: SOX9 Antibody [NBP1-85551] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunocytochemistry/Immunofluorescence: SOX9 Antibody [NBP1-85551] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human colorectal cancer shows moderate to strong nuclear positivity in tumor cells.

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human glioma shows moderate to strong nuclear positivity in tumor cells.

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human small intestine shows moderate nuclear positivity in a subset of glandular cells.

Immunohistochemistry-Paraffin: SOX9 Antibody [NBP1-85551] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.

Simple Western: SOX9 Antibody [NBP1-85551] - Simple Western lane view shows a specific band for SOX9 in 0.1 mg/ml of U-251MG sp (left) and HepG2 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: SOX9 Antibody [NBP1-85551] - Electropherogram image(s) of corresponding Simple Western lane view. SOX9 antibody was used at 1:100 dilution on U-251MG sp and HepG2 lysates(s).

Immunohistochemistry of candidate biomarkers in prostate cancer. Representative immunohistochemical staining of ACPP, ADAM9, ALDH1A2, CASR, CCND1, CCPG1, CD34, CD44, CD44v6, CHGA, CHMP1A, EI24, ENO2, GADD45B, HA, HAS2, HES6, HMMR, HOXC6, HYAL1, IGF1, IQCK, MAP4K4, MKI67, PAGE4, PLIN2, PTEN, SIAH2, SMAD4, SOX9, SPP1, SYP, & TP53 from prostate cancer tissue microarrays. Scale bar represents 50 μm. Image collected & cropped by CiteAb from the following publication (//bmccancer.biomedcentral.com/articles/10.1186/1471-2407-14-244), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt, Po, Ca
• Applications: WB, Simple Western, ICC/IF, IHC, GS, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOX9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SQRTHIKTEQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTR
• Marker: Sertoli Cell Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOX9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Gel Supershift Assay Reported in scientific literature (PMID: 26430891).
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID:32103177).
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100br/>In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in U-251MG sp and HepG2, separated by Size, antibody dilution of 1:100, apparent MW was 59 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  SOX9 Protein (NBP1-85551PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33645550). Porcine reactivity reported in scientific Iliterature (PMID: 26430891). Use in Canine reported in scientific literature (PMID:26428883).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SOX9 Antibody - BSA Free

• campomelic dysplasia, autosomal sex-reversal
• CMD 1
• CMD1
• CMPD1
• SOX9
• SRA1SRY (sex-determining region Y)-box 9 protein
• SRY (sex determining region Y)-box 9
• SRY-related HMG-box, gene 9
• transcription factor SOX-9

Background

SOX9 is a member of the family of SOX (Sry-type highmobility group box) genes that were first identified on the basis of region with high homology to that of Sry (Sex determining region Y). SOX9 is a transcription factor with a high mobility group DNA-binding domain that is expressed in all prechondrocytic and chondrocytic cells during embryonic development in a pattern that close parallels that of the gene for type II collagen. SOX9 is important in neural crest formation, and is involved in regulating subsequent epithelial-mesenchymal transition and migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOX9 Antibody (NBP1-85551)(25)

Publications using NBP1-85551

• Yano-Sakamoto K, Kitai Y, Toriu N et al. Expression pattern of Runt-related transcription factor (RUNX) family members and the role of RUNX1 during kidney development. Biochemical and biophysical research communications 2024-06-14 [PMID: 38795454]
• Waters BJ, Birman ZR, Wagner MR et al. Islet architecture in adult mice is actively maintained by Robo2 expression in ? cells Developmental biology 2023-11-15 [PMID: 37972678] (IHC, Mouse)
• Lu JH, Chueh KS, Juan TJ et al. Effects of Therapeutic Platelet-Rich Plasma on Overactive Bladder via Modulating Hyaluronan Synthesis in Ovariectomized Rat International journal of molecular sciences 2023-05-04 [PMID: 37175945] (WB, Rat)
• Chen HJ, Barske L, Talbot JC et al. Nuclear receptor Nr5a2 promotes diverse connective tissue fates in the jaw Developmental cell 2023-03-27 [PMID: 36905926]
• Deepe R, Drummond J, Wolters R et al. Sox9 Expression in the Second Heart Field; A Morphological Assessment of the Importance to Cardiac Development with Emphasis on Atrioventricular Septation Journal of Cardiovascular Development and Disease 2022-11-02 [PMID: 36354775] (IHC-Fr, Mouse)
• Baek I, Bello AB, Jeon J et al. Therapeutic potential of epiphyseal growth plate cells for bone regeneration in an osteoporosis model Journal of tissue engineering 2022-08-11 [PMID: 35983547] (WB, Rat)
  
  Details:
  EGPCs and BM-MSCs were isolated from 8 weeks old Sprague Dawley (SD) male rat. Dilution used 1:1000.
• Liu Q, Guo Q, Guo W et al. Loss of CEP70 function affects acrosome biogenesis and flagella formation during spermiogenesis Cell death & disease 2021-05-12 [PMID: 33980814] (IF/IHC, Mouse)
• Winkler A, Wrzos C, Haberl M et al. Blood-brain barrier resealing in neuromyelitis optica occurs independently of astrocyte regeneration The Journal of clinical investigation 2021-03-01 [PMID: 33645550] (Rat)
• Deepe R, Fitzgerald E, Wolters R et al. The Mesenchymal Cap of the Atrial Septum and Atrial and Atrioventricular Septation J Cardiovasc Dev Dis 2020-11-04 [PMID: 33158164] (IF/IHC, Mouse)
• Alencar GF, Owsiany KM, Karnewar S et Al. Stem Cell Pluripotency Genes Klf4 and Oct4 Regulate Complex SMC Phenotypic Changes Critical in Late-Stage Atherosclerotic Lesion Pathogenesis Circulation 2020-07-17 [PMID: 32674599]
• Stegen S, Rinaldi G, Loopmans S, Stockmans I et Al. Glutamine Metabolism Controls Chondrocyte Identity and Function Dev Cell 2020-05-30 [PMID: 32470321]
• van Gastel N, Stegen S, Eelen G et al. Lipid availability determines fate of skeletal progenitor cells via SOX9 Nature 2020-02-26 [PMID: 32103177] (IHF-Fr, IHC-P, Mouse)
• Tournaire G, Stegen S, Giacomini G et al. Nestin-GFP transgene labels skeletal progenitors in the periosteum Bone 2020-04-01 [PMID: 32036051]
• Cheng B, Liu Y, Zhao Y et al. The role of anthrax toxin protein receptor 1 as a new mechanosensor molecule and its mechanotransduction in BMSCs under hydrostatic pressure Sci Rep 2019-09-02 [PMID: 31477767] (WB, Rat)
• Roberts RR, Bobzin L, Teng CS et al. FGF signaling patterns cell fate at the interface between tendon and bone Development 2019-07-18 [PMID: 31320326]
• Kaczmarek-Hajek K, Zhang J, Kopp R et al. Re-evaluation of neuronal P2X7 expression using novel mouse models and a P2X7-specific nanobody. Elife 2018-08-03 [PMID: 30074479] (IF/IHC, Human)
• Leijten J, Teixeira LS, Bolander J et al. Bioinspired seeding of biomaterials using three dimensional microtissues induces chondrogenic stem cell differentiation and cartilage formation under growth factor free conditions. Sci Rep. 2016-11-03 [PMID: 27808102] (Human)
• Brenig B, Duan Y, Xing Y et al. Porcine SOX9 Gene Expression Is Influenced by an 18 bp Indel in the 5'-Untranslated Region. PLoS One 2015-01-01 [PMID: 26430891] (EMSA, Porcine)
• Fantinato E, Milani L et al. Sox9 expression in canine epithelial skin tumors. Eur J Histochem 2015-09-07 [PMID: 26428883] (IF/IHC, Canine)
• Chen YH, Chen HL, Chien CS et al. Contribution of Mature Hepatocytes to Biliary Regeneration in Rats with Acute and Chronic Biliary Injury. PLoS One 2015-01-01 [PMID: 26308208] (IF/IHC, Rat)
• Capaccione KM, Hong X, Morgan KM et al. Sox9 mediates Notch1-induced mesenchymal features in lung adenocarcinoma. Oncotarget 2014-06-15 [PMID: 25004243] (WB, IF/IHC, Human)
• Bruun J, Kolberg M, Nesland JM et al. Prognostic Significance of beta-Catenin, E-Cadherin, and SOX9 in Colorectal Cancer: Results from a Large Population-Representative Series. Front Oncol 2014-01-01 [PMID: 24904831]
• Rizzardi AE, Rosener NK, Koopmeiners JS et al. Evaluation of protein biomarkers of prostate cancer aggressiveness. BMC Cancer 2014-04-05 [PMID: 24708576] (IF/IHC, Human)
• Poulsen RC, Knowles HJ, Carr AJ et al. Cell differentiation versus cell death: extracellular glucose is a key determinant of cell fate following oxidative stress exposure. Cell Death Dis 2014-02-20 [PMID: 24556689]
• Vestentoft PS et al. Three-dimensional reconstructions of intrahepatic bile duct tubulogenesis in human liver. BMC Dev Biol;11:56. 2011-09-26 [PMID: 21943389]

Review for SOX9 Antibody (NBP1-85551) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 01/30/2019

Summary

• Application: Western Blot
• Sample Tested: 293T lysates
• Species: Human
• Lot: F115596

Bioinformatics

• Gene Symbol: SOX9
• Entrez:
  • 6662(Human)
• Uniprot:
  • P48436()