TDO2 Antibody - Azide and BSA Free

Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot. The total protein (20 ug) of the dentate gyrus, extracted from the wild-type (lanes 1 and 3) and Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, and transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta-Tubulin is a positive control for the Western blot. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate(44.66 KDa). Lane 2: Non-transfected lysate.

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. In the cerebellum, the immunoreactivity for TDO was observed in granule cells and Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Western Blot: TDO2 Antibody [H00006999-B01P] - Analysis of TDO2 expression in human liver.

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. A TDO was not stained in the SVZ. The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, and the cerebellum. TDO was not stained in the olfactory bulb (OB). The immunoreactivities for TDO in wild type and Tdo-/- mice were background level. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by immunofluorescent staining. The hippocampal sections of wild-type and Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo -/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected and cropped by CiteAb from the following publication (//molecularbrain.biomedcentral.com/articles/10.1186/1756-6606-3-26), licensed under a CC-BY license.

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [H00006999-B01P] - Immunoreactivity of TDO in the SVZ, the olfactory bulb, & the cerebellum. A & B: TDO was not stained in the SVZ (A) & the olfactory bulb (OB) (B). The immunoreactivities for TDO in wild type & Tdo-/- mice were background level. C: In the cerebellum, the immunoreactivity for TDO was observed in granule cells & Purkinje cells of wild type mice, but these positive structures disappeared in Tdo-/- mice. The cytoarchitectural organization of Tdo-/- mice was the same as that of wild type mice. E, external plexiform layer; G, granule cell layer; Gm, glomerular layer; I, internal plexiform layer; LV, lateral ventricle; Mi, mitral cell layer; Mo, molecular layer; P, Purkinje cell layer; St, striatum; Su, subependymal zone. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Western Blot: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Immunohistochemistry: TDO2 Antibody [H00006999-B01P] - Specificity of antibodies for tryptophan 2,3-dioxygenase (TDO) by Western blot (A) & immunofluorescent staining (B). A: The total protein (20 μg) of the dentate gyrus, extracted from the wild-type (lanes 1 & 3) & Tdo-/- mice (lane 2), was subjected to 4% to 12% gradient sodium dodecyl sulfate polyacrylamide gel electrophoresis, & transferred to polyvinylidene difluoride membranes. TDO was detected as described in the Methods section. Note that a 45-kDa band was detected with the anti-TDO antibody. The positions of molecular weight markers are shown on the left. Lane 3: negative control without the primary antibody. beta -Tubulin is a positive control for the Western blot. B: The hippocampal sections of wild-type & Tdo-/- mice were stained with anti-TDO antibody. In sections of Tdo-/- mice, immunofluorescence signals were not detected in granule cells, interneurons (arrowhead), CA1, or CA3 cells, suggesting that the secondary antibody used in this study bound specifically to the primary antibody (mouse IgG). g, granule cell layer; h, hilus. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/20815922), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TDO2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TDO2 (NP_005642.1, 1 a.a. - 406 a.a.) full-length human protein. MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
• Specificity: TDO2 - tryptophan 2,3-dioxygenase,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TDO2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27190010). Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TDO2 Antibody - Azide and BSA Free

• chky
• TDO
• TDO2
• TDOTO
• TO
• TPH2EC 1.13.11.11
• TRPO
• TRPOtryptophanase
• Tryptamin 2,3-dioxygenase
• tryptophan 2,3-dioxygenase
• Tryptophan Oxygenase
• Tryptophan Pyrrolase
• Tryptophanase

Background

Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TDO2 Antibody (H00006999-B01P)(7)

Publications using H00006999-B01P

• R Lee, J Li, J Li, CJ Wu, S Jiang, WH Hsu, D Chakravart, P Chen, KA LaBella, J Li, DJ Spring, D Zhao, YA Wang, RA DePinho Synthetic Essentiality of Tryptophan 2,3-dioxygenase 2 in APC-Mutated Colorectal Cancer Cancer Discovery, 2022-07-06;0(0):. 2022-07-06 [PMID: 35537038]
• Quoc P, Daiki T, Shintaro A et al. TDO2 overexpression correlates with poor prognosis, cancer stemness, and resistance to cetuximab in bladder cancer. Cancer Rep (Hoboken). 2021-06-07 [PMID: 34101386]
• M Terai, E Londin, A Rochani, E Link, B Lam, G Kaushal, A Bhushan, M Orloff, T Sato Expression of Tryptophan 2,3-Dioxygenase in Metastatic Uveal Melanoma Cancers (Basel), 2020-02-10;12(2):. 2020-02-10 [PMID: 32050636]
• Pham QT, Oue N, Sekino Y et al. TDO2 Overexpression Is Associated with Cancer Stem Cells and Poor Prognosis in Esophageal Squamous Cell Carcinoma. Oncology 2018-08-22 [PMID: 30134247]
• Woodling NS, Colas D, Wang Q et al. Cyclooxygenase inhibition targets neurons to prevent early behavioural decline in Alzheimer's disease model mice. Brain. 2016-05-13 [PMID: 27190010] (WB, Mouse)
• D'Amato NC, Rogers TJ, Gordon MA et al. A TDO2-AhR Signaling Axis Facilitates Anoikis Resistance and Metastasis in Triple-Negative Breast Cancer. Cancer Res 2015-09-11 [PMID: 26363006]
• Ohira K, Hagihara H, Toyama K et al. Expression of tryptophan 2,3-dioxygenase in mature granule cells of the adult mouse dentate gyrus. Mol Brain. 2010-09-05 [PMID: 20815922]

FAQs for TDO2 Antibody (H00006999-B01P). (Showing 1 - 1 of 1 FAQs).

1. Why do you guys see two different molecular weight bands, one around 46 kDa in HEK cell lysates and the other around 50 kDa in liver lysates?  ..show answer..
   • From the data I have available, the reason you see the molecular weight running slightly lower in the HEK lysate is because these cells were transfected with a partial length protein (a few aa short of the full length). The liver lysate will show you the correct sizing of the endogenous expression. The theoretical molecular weight of this protein is ~48kDa. However the observed weight can vary slightly due to your experimental conditions.

Bioinformatics

• Gene Symbol: TDO2
• Entrez:
  • 6999(Human)
• Uniprot:
  • NP_005642.1(Human)