TGF-beta 1 Antibody - BSA Free

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Immunocytochemistry/Immunofluorescence: TGF-beta 1 Antibody [NBP1-80289] - Mouse kidney (red fluorescence). Nuclei were stained with DAPI (blue fluorescence). Working dilutions: 5-10 ug/ml

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Appendix FFPE tissue section stained with TGF-beta 1 antibody. IHC-P image submitted by a verified customer review.

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Antibody Titration: 0.2-1 ug/ml or 1:5000 to 1:1000 Dilution. SP2/0 cell lysate.

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Spleen. Antibody Dilution: 1ug/ml

Western Blot: TGF-beta 1 Antibody [NBP1-80289] - Sample Tissue: Mouse Pancreas. Antibody Dilution: 1ug/ml

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human Spleen Tissue, 5 ug/ml.

Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human prostate cancer tissue was detected using RP/AEC red color stain. Working dilutions: 5-10 ug/ml.

Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289] - Human bone marrow FFPE tissue sections. DNA in blue, TGF-beta 1 antibody staining in white. IMC image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: Rabbit Polyclonal TGF-beta 1 Antibody [NBP1-80289] - Mice hepatocytes stained with TGF-beta 1 Antibody. Image from a verified customer review.

• Reactivity: Hu, Mu, Po
• Applications: WB, ICC/IF, IHC, MS
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TGF-beta 1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TGFB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Imaging Mass Cytometry
  • Immunocytochemistry/ Immunofluorescence 5-10 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 5-10 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review.
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Reactivity Notes

Porcine reactivity reported in scientific literature (PMID: 23616520).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TGF-beta 1 Antibody - BSA Free

• CEDLAP
• DPD1
• latency-associated peptide
• TGF beta
• TGF beta1
• TGFB
• TGFB1
• TGF-beta 1 protein
• TGFbeta 1
• TGF-beta 1
• TGFbeta
• TGF-beta-1
• transforming growth factor beta-1
• transforming growth factor, beta 1

Background

TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TGF-beta 1 Antibody (NBP1-80289)(9)

Publications using NBP1-80289

• Yamawaki Y, Parvez M, Wada Y et al. Environmental stress insults in 2HIT model synergistically produce disorder-associated microglia and macrophages in the cerebellum Research Square 2023-02-21 (IHC, Mouse)
• Liu L, Gao J, Tang Y et Al. Increased expression of the P2Y(12) receptor is involved in the failure of autogenous arteriovenous fistula caused by stenosis Ren Fail 2023-11-23 [PMID: 38532720]
• Xu M, Tan J, Zhu L et al. Palmitoyltransferase ZDHHC3 Aggravates Nonalcoholic Steatohepatitis by Targeting S-Palmitoylated IRHOM2 Advanced science (Weinheim, Baden-Wurttemberg, Germany) 2023-08-06 [PMID: 37544908]
• Medipally A, Xiao M, Satoskar AA et al. N-acetylcysteine ameliorates hematuria-associated tubulointerstitial injury in 5/6 nephrectomy mice Physiological reports 2023-07-01 [PMID: 37419616] (IHC-P, Mouse)
• Ma C, Wang L, Liao W et al. TGF- beta promotes stem-like T cells via enforcing their lymphoid tissue retention The Journal of experimental medicine 2022-10-03 [PMID: 35980385]
• Chung S, Overstreet JM, Li Y et al. TGF-b promotes fibrosis after severe acute kidney injury by enhancing renal macrophage infiltration. JCI Insight. 2018-11-02 [PMID: 30385721] (WB, Mouse)
• Herrmann J, Wohlert C, Saguner AM et al. Primary proteasome inhibition results in cardiac dysfunction. Eur J Heart Fail 2013-04-24 [PMID: 23616520] (WB, Porcine)
• Nordquist EM Exploring Heart Valve Homeostasis and Repair Thesis 2021-01-01 (IHC-P, Mouse)
• Yao G, Mo X, Yin C et al. A programmable and skin temperature-activated electromechanical synergistic dressing for effective wound healing Science advances 2022-01-28 [PMID: 35080981] (IF/IHC, Rat)

Reviews for TGF-beta 1 Antibody (NBP1-80289) (3)

Average Rating: 4.7

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Mouse.

reviewed by: Armen Petrosyan IF Mouse 11/19/2024

Summary

• Application: Immunofluorescence
• Sample Tested: Primary mouse hepatocytes
• Species: Mouse
• Lot: QC77990

reviewed by: Michela Colombo IMC Human 11/12/2021

Summary

• Application: Imaging Mass Cytometry
• Sample Tested: bone marrow
• Species: Human
• Lot: qc49893-190822

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

reviewed by: Verified Customer IHC-P Human 09/16/2016

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Appendix FFPE section
• Species: Human
• Lot: qc49894-42474

Bioinformatics

• Gene Symbol: TGFB1
• Uniprot:
  • NP_035707(Mouse)