Immunohistochemistry-Paraffin: TGF-beta 1 Antibody [NBP1-80289] - Human prostate cancer tissue was detected using RP/AEC red color stain. Working dilutions: 5-10 ug/ml.
Imaging Mass Cytometry: TGF-beta 1 Antibody [NBP1-80289] - Human bone marrow FFPE tissue sections. DNA in blue, TGF-beta 1 antibody staining in white. IMC image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: Rabbit Polyclonal TGF-beta 1 Antibody [NBP1-80289] - Mice hepatocytes stained with TGF-beta 1 Antibody. Image from a verified customer review.
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TGFB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
This TGF-beta 1 Antibody is validated for Imaging Mass Cytometry from a verified customer review.
Theoretical MW
43 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 3 Reviews rated 4.7 using NBP1-80289 in the following applications:
Porcine reactivity reported in scientific literature (PMID: 23616520).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for TGF-beta 1 Antibody - BSA Free
CEDLAP
DPD1
latency-associated peptide
TGF beta
TGF beta1
TGFB
TGFB1
TGF-beta 1 protein
TGFbeta 1
TGF-beta 1
TGFbeta
TGF-beta-1
transforming growth factor beta-1
transforming growth factor, beta 1
Background
TGF-beta-1 is a multifunctional cytokine that belongs to a superfamily of structurally related regulatory proteins, which includes three mammalian TGF-beta isoforms (TGF-beta-1, -beta-2, and -beta-3), activin/inhibins and bone morphogenetic proteins. The most abundant isoform, TGF-beta-1, is a 25kDa homodimer composed of two 12.5kDa subunits joined by disulfide bonds. TGF-beta-1 is a highly conserved molecule - the amino acid sequence between human and mouse differ only by one residue. Although originally defined by its ability to cause anchorage independent cell growth and changes in cell morphology of rat fibroblasts, subsequent research has revealed that TGF-beta is actually a major growth inhibitor for most cell types. It is produced by a wide variety of cell and tissue types during all stages of cell differentiation. TGF-beta-1 sources include platelets, bone and soft tissues such as placenta and kidneys.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Yamawaki Y, Parvez M, Wada Y et al. Environmental stress insults in 2HIT model synergistically produce disorder-associated microglia and macrophages in the cerebellum Research Square 2023-02-21 (IHC, Mouse)
***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.