TMEM106B Antibody - BSA Free

Western Blot: TMEM106B Antibody [NBP1-91311] - Mouse Brain Lysate 1ug/ml Gel Concentration 12%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TMEM106B Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence AEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDC. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM106B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMEM106B Antibody - BSA Free

• TMEM106B
• transmembrane protein 106B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM106B Antibody (NBP1-91311)(2)

Publications using NBP1-91311

• Chang A, Xiang X, Wang J et al. Homotypic fibrillization of TMEM106B across diverse neurodegenerative diseases Cell 2022-03-01 [PMID: 35247328]
• Johnson NR, Condello C, Guan S et al. Evidence for sortilin modulating regional accumulation of human tau prions in transgenic mice Proc. Natl. Acad. Sci. U.S.A. 2017-12-19 [PMID: 29203673] (Mouse)

Bioinformatics

• Gene Symbol: TMEM106B
• Uniprot:
  • NP_082268(Mouse)