TMEM119 Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining in human lymph node and liver tissues. Corresponding TMEM119 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-TMEM119 antibody NBP2-30551 (A) shows similar protein distribution across tissues to independent antibody NBP2-30792 (B).

Immunocytochemistry/Immunofluorescence: TMEM119 Antibody [NBP2-30551] - Human microglia cell line stained with TMEM antibody and DAPI. ICC/IF image submitted by a verified customer review.

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human cerebral cortex shows weak positivity in microglia.

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Immunohistochemistry-Paraffin: TMEM119 Antibody [NBP2-30551] - Staining of human testis shows weak membranous positivity in cells in lamina propria.

• Reactivity: Hu, Rt, Po, Fe
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM119 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ITRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM119
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Verified from a customer review. Reported in scientific literature (PMID: 29109020).
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen Verified from a customer review.
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMEM119 Protein (NBP2-30551PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Feline, Porcine reactivity reported from verified customer reviews.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2), 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM119 Antibody - BSA Free

• OBIF
• Osteoblast Induction Factor
• TMEM119

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM119 Antibody (NBP2-30551)(11)

Publications using NBP2-30551

• Lisi L, Olivi A, Ciotti GMP et Al. A topographic approach to the markers of macrophage/microglia and other cell types in high grade glioma Neurochem Int 2024-12-27 [PMID: 39734023]
• Xu J, Zhang L, Li M et al. TREM2 mediates physical exercise-promoted neural functional recovery in rats with ischemic stroke via microglia-promoted white matter repair Journal of neuroinflammation 2023-02-25 [PMID: 36829205] (IHC, Rat)
• Wang F, Zhang Z, Han J et al. Discovery of microglia gonadotropin?releasing hormone receptor and its potential role in polycystic ovarian syndrome Molecular medicine reports 2023-04-01 [PMID: 36799164] (ICC/IF, Rat)
  
  Details:
  Dilution used in WB 1:200
• You MJ, Rim C, Bang M et al. A molecular characterization and clinical relevance of microglia-like cells derived from patients with panic disorder Translational psychiatry 2023-02-07 [PMID: 36750547] (ICC/IF, Human)
• Hubschmann V, Korkut-Demirbas M, Siegert S. Assessing human iPSC-derived microglia identity and function by immunostaining, phagocytosis, calcium activity, and inflammation assay STAR Protocols 2022-12-01 [PMID: 36595902] (ICC/IF, Human)
  
  Details:
  1:100 dilution ICC/IF
• Bartalska K, Hubschmann V, Korkut-Demirbas M et al. A systematic characterization of microglia-like cell occurrence during retinal organoid differentiation iScience 2022-07-01 [PMID: 35789843] (IF/IHC, Human)
• Akiyama H, Jalloh S, Park S et al. Expression of HIV-1 Intron-Containing RNA in Microglia Induces Inflammatory Responses Journal of virology 2020-12-09 [PMID: 33298546] (ICC/IF)
• Jackson L, Dumanli S, Johnson M et al. Microglia Knockdown Reduces Inflammation and Preserves Cognition in Diabetic Animals After Experimental Stroke J Neuroinflammation. 2020-04-28 [PMID: 32345303] (ICC/IF, Rat)
• Kim Hy, Kim Tj, Kang L et Al. Mesenchymal stem cell-derived magnetic extracellular nanovesicles for targeting and treatment of ischemic stroke Biomaterials 2020-06-01 [PMID: 32179302] (IHC-P, IF/IHC, Rat)
• Jackson L, Dong G, Althomali W, et al. Delayed Administration of Angiotensin II Type 2 Receptor (AT2R) Agonist Compound 21 Prevents the Development of Post-stroke Cognitive Impairment in Diabetes Through the Modulation of Microglia Polarization Transl Stroke Res 2019-12-03 [PMID: 31792796]
• Seigel GM, Manohar S, Bai YY et al. An immortalized microglial cell line (Mocha) derived from rat cochlea Mol. Cell. Neurosci. 2017-12-01 [PMID: 29109020] (ICC/IF, Rat)

Reviews for TMEM119 Antibody (NBP2-30551) (5)

Average Rating: 2.6

(Based on 5 reviews)

We have 5 reviews tested in 5 species: Human, Rat, Feline, Sheep, Swine.

reviewed by: Verified Customer ICC Human 05/20/2021

Summary

• Application: Immunocytochemistry
• Sample Tested: Human microglia
• Species: Human
• Lot: b118061

reviewed by: Verified Customer IHC-Fr Rat 07/28/2020

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Adult brain,Coronal rat brain slices
• Species: Rat
• Lot: B118061

Comments

• Comments: Rats were perfused with 4% paraformaldehyde in PBS (pH=7.6). The brain was removed and immersed in PFA then in 30% sucrose. The brain was sliced with a freezing microtome. A mixture of 1% Triton-X and 10% donkey serum (in TRIS) was used for antigen retrieval and blocking. Tmem119 antibody was used in 1:100 dilution and was visualized by an Alexa-488 conjugated anti-rabbit secondary antibody (1:200). Cell bodies were stained with NeuroTrace 640/660 (1:250). ***Bio-Techne Response: Thank you for reviewing our product. We are sorry to hear that this product did not perform as expected. We have been in touch with the customer to resolve this issue according to our Product Guarantee and to the customer’s satisfaction.***

reviewed by: Verified Customer IHC-Fr Sheep 03/13/2020

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Brain (hypothalamus) tissue
• Species: Sheep
• Lot: C119313

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.*** To test, we used free-floating sheep hypothalamic brain sections from two animals. We did dilutions of 1:100 to 1:1000 and did not see any staining in our tissue using this antibody NBP2-30551. We also employed an antigen retrieval step in one of our runs, and it did not yield any positive staining.

reviewed by: Vicki Swier IHC-P Swine 04/23/2018

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: brain (aqueduct),Brain (cerebral cortex),Brain (hippocampus) tissue,brain (thalamus)
• Species: Swine
• Lot: B114525

Comments

• Comments: 1:100 dilution. 5 minute DAB stain. Polymer secondary. pH 6 Citrate buffer used for antigen retrieval by steam heat.

reviewed by: Verified Customer IHC-Fr Feline 01/31/2017

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: Nerve pia mater,optic nerve
• Species: Feline
• Lot: B106244

Comments

• Comments: PFA fixed and cryoprotected tissue.

Bioinformatics

• Gene Symbol: TMEM119
• Uniprot:
  • Q4V9L6()