TMEM132A Antibody - BSA Free

Immunohistochemistry-Paraffin: TMEM132A Antibody [NBP2-14753] - Staining in human cerebral cortex and pancreas tissues using anti-TMEM132A antibody. Corresponding TMEM132A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: TMEM132A Antibody [NBP2-14753] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: TMEM132A Antibody [NBP2-14753] - Staining of human cerebral cortex shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TMEM132A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TMEM132A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TMEM132A Protein (NBP2-14753PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TMEM132A Antibody - BSA Free

• GBP
• HSPA5BP1
• TMEM132A transmembrane protein 132A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TMEM132A