TOMM20 Antibody - BSA Free

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in human cell lines HEK293 and MCF-7. Corresponding TOMM20 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Western Blot: TOMM20 Antibody [NBP1-81556] - Analysis in mouse cell line NIH-3T3.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Z-stack confocal images with SRRF (super-resolution radial fluctuations) analysis of Tomm20, an outer mitochondrial membrane protein, in HeLa cells. Tomm20 was detected in HeLa cells using 1 ug/ml Rb anti-Tomm20 (NBP1-81556) and 1:500 JF646-conjugated anti-Rb secondary antibody (red). Cells were counterstained with Dapi (blue). Image submitted by a verified customer review.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human duodenum shows moderate to strong positivity in mitochondria in glandular cells.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM. Image submitted by a verified customer review.

Immunocytochemistry/Immunofluorescence: TOMM20 Antibody [NBP1-81556] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human endometrium shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human prostate shows moderate to strong positivity in mitochondria in glandular cells.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP1-81556] - Staining of human cerebral cortex shows moderate to strong positivity in mitochondria in neurons.

Simple Western: TOMM20 Antibody [NBP1-81556] - Simple Western lane view shows a specific band for TOMM20 in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: TOMM20 Antibody [NBP1-81556] - Electropherogram image(s) of corresponding Simple Western lane view. TOMM20 antibody was used at 1:30 dilution on RT-4 and U-251MG lysate(s).

Western Blot: TOMM20 Antibody [NBP1-81556] - Quantification of LC3B-II & TOM20 proteins in WT & Ts1Cje hippocampus. Hippocampal proteins from WT & Ts1Cje mice pairs were analyzed in Western blot with anti-LC3B or anti-TOM20 antibody. A LC3B western blot showing WT & Ts1Cje littermate pairs analyzed & total protein loaded. The ratio LC3B-II/LC3B-I is shown as the mean ± SEM (WT: 0.8714 ± 0.04154; Ts1Cje: 0.6500 ± 0.06802; p = 0.0152, Student’s t-test, n = 7 for WT & n = 6 for Ts1Cje). B TOM20 western blot showing WT & Ts1Cje littermate pairs analyzed & total protein loaded. The signals were normalized to the corresponding total protein loaded & the mean ± SEM values are shown (WT: 1.024 ± 0.08799; Ts1Cje: 1.412 ± 0.1452; p = 0.0414, Student’s t-test, n = 7 animals per genotype) Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34034796), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TOMM20 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDV
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM20
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:30, apparent MW was 18 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  TOMM20 Protein (NBP1-81556PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TOMM20 Antibody - BSA Free

• KIAA0016Outer mitochondrial membrane receptor Tom20
• MAS20
• MGC117367
• mitochondrial 20 kDa outer membrane protein
• mitochondrial import receptor subunit TOM20 homolo
• mitochondrial import receptor subunit TOM20 homolog
• MOM19
• outer mitochondrial membrane receptor Tom20
• TOM20
• TOMM20
• translocase of outer mitochondrial membrane 20 hom
• translocase of outer mitochondrial membrane 20 homolog (yeast)
• translocase of outer mitochondrial membrane 20 homolog type II

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TOMM20 Antibody (NBP1-81556)(10)

Publications using NBP1-81556

• Onuchic L, Padovano V, Schena G et al. The C-terminal tail of polycystin-1 suppresses cystic disease in a mitochondrial enzyme-dependent fashion Nature communications 2023-03-30 [PMID: 36997516] (WB, Mouse)
  
  Details:
  1:1000 WB dilution
• Ghosh P, Guo Y, Ashrafi A et al. Oxygen-enhanced optoacoustic tomography reveals the effectiveness of targeting heme and oxidative phosphorylation at normalizing tumor vascular oxygenation Cancer Res. 2020-06-16 [PMID: 32546631] (IF/IHC, Human)
• Li B, Zhao H, Wu Y et al. Mitochondrial-Derived Vesicles Protect Cardiomyocytes Against Hypoxic Damage Front Cell Dev Biol 2020-04-17 [PMID: 32426351] (ICC/IF, Rat)
• Iannielli A, Ugolini GS, Cordiglieri C, et al. Reconstitution of the Human Nigro-striatal Pathway on-a-Chip Reveals OPA1-Dependent Mitochondrial Defects and Loss of Dopaminergic Synapses Cell Rep 2019-12-24 [PMID: 31875567] (IF/IHC)
• Sala, D;Cunningham, TJ;Stec, MJ;Etxaniz, U;Nicoletti, C;Dall'Agnese, A;Puri, PL;Duester, G;Latella, L;Sacco, A; The Stat3-Fam3a axis promotes muscle stem cell myogenic lineage progression by inducing mitochondrial respiration Nat Commun 2019-04-17 [PMID: 30996264] (ICC/IF, Mouse)
• Ward JM, Stoyas CA, Switonski PM et al. Metabolic and Organelle Morphology Defects in Mice and Human Patients Define Spinocerebellar Ataxia Type 7 as a Mitochondrial Disease Cell Rep 2019-01-29 [PMID: 30699348] (WB, Mouse)
• Weber TA, Koob S, Heide H et al. APOOL Is a Cardiolipin-Binding Constituent of the Mitofilin/MINOS Protein Complex Determining Cristae Morphology in Mammalian Mitochondria. PLoS One 2013-01-01 [PMID: 23704930]
• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]
• Cassina, L, Chiaravalli, M Et al. Increased mitochondrial fragmentation in polycystic kidney disease acts as a modifier of disease progression. FASEB J 2020-05-01 [PMID: 32239723] (WB)

Reviews for TOMM20 Antibody (NBP1-81556) (3)

Average Rating: 4.3

(Based on 3 reviews)

We have 3 reviews tested in 2 species: Human, Human and Mouse.

reviewed by: Verified Customer ICC Human 10/31/2020

Summary

• Application: Immunocytochemistry
• Sample Tested: Human primary fibroblast
• Species: Human
• Lot: e118816

Comments

• Comments: PFA 4% 15 min fixed. Ab incubation:1:200 dilution O/N 4ºC in 10% Donkey Serum in PBST (0.1% Triton). Secondary antibody Donkey anti-rabbit Alexa Fluor 488 1:500 2h RT in 10% Donkey Serum in PBST (0.1% Triton).

reviewed by: Verified Customer WB Human and Mouse 06/29/2017

Summary

• Application: Western Blot
• Sample Tested: 293FT cell lysate,nih3t3 cell lysate
• Species: Human and Mouse
• Lot: b105898

reviewed by: Steve Gillmore ICC Human 04/10/2017

Summary

• Application: Immunocytochemistry
• Sample Tested: Retinal Pigmented Epithelial Cells
• Species: Human

Comments

• Comments: RPE1 cells were fixed with 4% PFA, permeablized and blocked in 2.5% BSA with 0.2% Triton-X. Primary antibody was diluted 1:200 in PBS containing 2.5% BSA overnight at 4 deg C. Cells were incubated with anti-rabbit secondary antibody and counterstained with hoescht 33342. Image was collected using Zeiss 780 LSM.

Bioinformatics

• Gene Symbol: TOMM20