Trappin-2/Elafin/Skalp Antibody - BSA Free

Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining in human esophagus and liver tissues using NBP1-85690 antibody. Corresponding PI3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining of human esophagus shows moderate membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: Trappin-2/Elafin/Skalp Antibody [NBP1-85690] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Trappin-2/Elafin/Skalp Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PI3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB and IHC reactivity reported in (PMID: 27444067).
• Control Peptide:

  Trappin-2/Elafin/Skalp Protein (NBP1-85690PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23631827)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Trappin-2/Elafin/Skalp Antibody - BSA Free

• cementoin
• Elafin
• Elastase-specific inhibitor
• ESI
• ESIWAP four-disulfide core domain protein 14
• Peptidase inhibitor 3
• peptidase inhibitor 3, skin-derived
• PI3
• PI-3
• pre-elafin
• protease inhibitor 3, skin-derived (SKALP)
• Protease inhibitor WAP3
• SKALP
• SKALPELAFIN
• Skin-derived antileukoproteinase
• Trappin2
• Trappin-2
• WAP four-disulfide core domain 14
• WAP3MGC13613
• WFDC14elafin

Background

The Skalp gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Trappin-2/Elafin/Skalp Antibody (NBP1-85690)(3)

Publications using NBP1-85690

• Scott HA, Quach B, Yang X et al. Matrix stiffness exerts biphasic control over monocyte-endothelial adhesion via Rho-mediated ICAM-1 clustering Integr Biol (Camb) 2016-07-22 [PMID: 27444067] (WB, IF/IHC, Human)
• McGovern JA, Meinert C, de Veer SJ et al. Attenuated kallikrein-related peptidase activity disrupts desquamation and leads to stratum corneum thickening in human skin equivalent models. Br J Dermatol 2016-07-21 [PMID: 27442805]
• Qundos U, Hong MG, Tybring G et al. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. J Proteomics 2013-12-16 [PMID: 23631827]

Bioinformatics

• Gene Symbol: PI3