TSC2 Antibody - BSA Free

Western Blot: TSC2 Antibody [NBP1-82849] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: TSC2 Antibody [NBP1-82849] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TSC2 Antibody [NBP1-82849] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TSC2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVLPSFYQAMACPNEVVSYEIVLSITRLIKKYRKELQVVAWDILLNIIERLLQQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQE
• Predicted Species: Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSC2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TSC2 Protein (NBP1-82849PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSC2 Antibody - BSA Free

• LAM
• LAMFLJ43106
• TSC2
• TSC4
• Tuberin
• Tuberous sclerosis 2 protein
• tuberous sclerosis 2

Background

Tuberous sclerosis complex-2 (TCS2 also known as Tuberin) is a tumor suppressor that forms a complex with TSC1 (Hamartin ) and this complex is known to control various cellular functions including cell cycle, endocytosis, adhesion, and transcription (1). The C-terminal region of TSC2 contains a GTPase-activating protein (GAP) domain which interacts with Rap1, Rab5 and Rheb (2). The TSC1/TSC2 complex inhibits phosphorylation of S6kinase and 4E-BP1 through inactivation of mTOR (3). Additionally, binding of 14-3-3 beta to TSC2 at Ser1210 reduce the ability of the complex to inhibit phosphorylation of S6 kinase (4). Phosphorylation by ATK at Ser924 and Thr1518 inactivates TSC2 and disrupts its interaction with TSC1 (5). Tuberous sclerosis (TSC), an autosomal dominant disorder that affects 1 in 6000 individuals, is caused by a mutation in either the TSC1 or TSC2 tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TSC2