TSG-6 Antibody

Western Blot: TSG-6 Antibody [NBP2-38637] - Analysis in human cell line PC-3 and human cell line HeLa.

Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human tonsil shows no positivity in lymphoid cells as expected.

Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human fallopian tube shows moderate positivity in plasma.

Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.

Immunohistochemistry-Paraffin: TSG-6 Antibody [NBP2-38637] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells, as well as moderate positivity in plasma.

Product Discontinued

TSG-6 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGFQIKYVAMDPVSKSSQ
• Predicted Species: Mouse (93%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFAIP6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TSG-6 Antibody

• Hyaluronate-binding protein
• TNF alpha-induced protein 6
• TNFAIP6
• TNF-stimulated gene 6 protein
• TSG6
• TSG-6
• TSG-6tumor necrosis factor alpha-inducible protein 6
• TSG6tumor necrosis factor-inducible gene 6 protein
• Tumor necrosis factor alpha-induced protein 6
• tumor necrosis factor, alpha-induced protein 6
• tumor necrosis factor-stimulated gene-6 protein

Background

TSG6 is encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. The expression of this gene can be induced by tumor necrosis factor alpha and interleukin-1. The expression can also be induced by mechanical stimuli in vascular smooth muscle cells, and is found to be correlated with proteoglycan synthesis and aggregation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TSG-6 Antibody (NBP2-38637)(1)

Publication using NBP2-38637

• Eikrem OS, Strauss P, Beisland C et al. Development and confirmation of potential gene classifiers of human clear cell renal cell carcinoma using next-generation RNA sequencing. Scand J Urol 2016-12-01 [PMID: 27739342] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TNFAIP6
• Uniprot:
  • P98066()