USP45 Antibody (1H2) - Azide and BSA Free

Western Blot: USP45 Antibody (1H2) [H00085015-M01] - USP45 monoclonal antibody (M01), clone 1H2. Analysis of USP45 expression in NIH/3T3.

Immunohistochemistry-Paraffin: USP45 Antibody (1H2) [H00085015-M01] - Analysis of monoclonal antibody to USP45 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

Western Blot: USP45 Antibody (1H2) [H00085015-M01] - USP45 monoclonal antibody (M01), clone 1H2. Analysis of USP45 expression in HeLa.

Western Blot: USP45 Antibody (1H2) [H00085015-M01] - USP45 monoclonal antibody (M01), clone 1H2. Analysis of USP45 expression in PC-12.

Western Blot: USP45 Antibody (1H2) [H00085015-M01] - USP45 monoclonal antibody (M01), clone 1H2. Analysis of USP45 expression in A-431.

Western Blot: USP45 Antibody (1H2) [H00085015-M01] - USP45 monoclonal antibody (M01), clone 1H2. Analysis of USP45 expression in human pancreas.

Sandwich ELISA: USP45 Antibody (1H2) [H00085015-M01] - Detection limit for recombinant GST tagged USP45 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 1H2
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

USP45 Antibody (1H2) - Azide and BSA Free Summary

• Immunogen: USP45 (XP_371838, 106 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVDFLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLG
• Specificity: USP45 - ubiquitin specific peptidase 45 (1H2)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: USP45
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for USP45 Antibody (1H2) - Azide and BSA Free

• Deubiquitinating enzyme 45
• EC 3.1.2.15
• EC 3.4.19.12
• MGC14793
• ubiquitin carboxyl-terminal hydrolase 45
• ubiquitin specific peptidase 45
• ubiquitin specific protease 45
• ubiquitin thioesterase 45
• Ubiquitin thiolesterase 45
• Ubiquitin-specific-processing protease 45
• USP45

Background

USP45 - ubiquitin specific protease 45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: USP45
• Entrez:
  • 85015(Human)
• Uniprot:
  • XP_371838(Human)