14-3-3 sigma/Stratifin Antibody - BSA Free

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining in human skin and skeletal muscle tissues using anti-SFN antibody. Corresponding SFN RNA-seq data are presented for the same tissues.

Western Blot: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Analysis in human cell lines A-431 and SK-MEL-30. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Immunocytochemistry/Immunofluorescence: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Western Blot: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Western Blot: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells.

Immunohistochemistry-Paraffin: 14-3-3 sigma/Stratifin Antibody [NBP1-80610] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

14-3-3 sigma/Stratifin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SFN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: PFA/Triton X-100
• Control Peptide:

  14-3-3 sigma/Stratifin Recombinant Protein Antigen (NBP1-80610PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for 14-3-3 sigma/Stratifin Antibody - BSA Free

• 14-3-3 protein sigma
• 1433 sigma
• 14-3-3 sigma
• Epithelial cell marker protein 1
• HME1
• SFN
• stratifin
• YWHAS

Background

14-3-3 sigma was identified as an epithelial cell marker. It is part of the 14-3-3 family of proteins in which seven isoforms have been identified: beta, zeta, gamma, eta, epsilon, tau, and sigma. 14-3-3 proteins function as adaptors that bind with a number of partners to mediate various signaling pathways. 14-3-3 sigma is also called stratifin or HME1 and appears to function as a tumor suppressor whose expression can be downregulated via methylation. Loss of 14-3-3 sigma expression results in a defective G2/M phase checkpoint and appears to contribute to both epithelial and non-epithelial tumorigenesis. Alternate names for 14-3-3 sigma include epithelial marker protein 1, SFN and YWHAS.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for 14-3-3 sigma/Stratifin Antibody (NBP1-80610)(2)

Publications using NBP1-80610

• Huimei C, Gabriel C, Nithya D et al. The E3 ubiquitin ligase WWP2 regulates pro-fibrogenic monocyte infiltration and activity in heart fibrosis Nature communications 2022-11-30 [PMID: 36450710] (IHC-P, Mouse)
• Tran V, NahlE S, Robert A Et al. Biasing the conformation of ELMO2 reveals that myoblast fusion can be exploited to improve muscle regeneration Nat Commun 2022-11-18 [PMID: 36400788] (IHC-Fr, Mouse)
  
  Details:
  Citation using the DyLight 650 version of this antibody.

Bioinformatics

• Gene Symbol: SFN
• Entrez:
  • 2810(Human)
• Uniprot:
  • P31947()
  • P31947()
  • P31947()
  • P31947()