ALAD Antibody - BSA Free

Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver

Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining in human adrenal gland and pancreas tissues using anti-ALAD antibody. Corresponding ALAD RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human pancreas shows low expression as expected.

Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.

Staining of human kidney, liver, pancreas and skeletal muscle using NBP1-89158 (A) shows similar protein distribution across tissues to independent antibody NBP1-89157 (B).

• Reactivity: Hu, Rt, Mu
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ALAD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ALAD Antibody - BSA Free (NBP1-89158) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-ALAD Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ALAD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in h. Liver and h. Adrenal lysates, separated by Size, antibody dilution of 1:200, apparent MW was 39 kDa
• Control Peptide:

  ALAD Protein (NBP1-89158PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 28857503).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ALAD Antibody - BSA Free

• ALADHEC 4.2.1.24
• aminolevulinate dehydratase
• aminolevulinate, delta-, dehydratase
• delta-aminolevulinic acid dehydratase
• PBGSMGC5057
• Porphobilinogen synthase

Background

The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALAD Antibody (NBP1-89158)(1)

Publication using NBP1-89158

• Moreno-Navarrete JM, Rodriguez A, Ortega F et al. Heme Biosynthetic Pathway is Functionally Linked to Adipogenesis via Mitochondrial Respiratory Activity Obesity (Silver Spring) 2017-10-01 [PMID: 28857503] (WB, Rat)

Bioinformatics

• Gene Symbol: ALAD