alpha-Defensin 1 Antibody - BSA Free

Western Blot: alpha-Defensin 1 Antibody [NBP3-05562] - Analysis of extracts of various cell lines, using DEFA1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit. Exposure time: 180s.

Immunocytochemistry/Immunofluorescence: alpha-Defensin 1 Antibody [NBP3-05562] - Immunofluorescence analysis of Jurkat cells using alpha-Defensin 1 Rabbit pAb (NBP3-05562) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: alpha-Defensin 1 Antibody - Azide and BSA Free [alpha-Defensin 1] - Immunofluorescence analysis of Jurkat cells using alpha-Defensin 1 Rabbit pAb at dilution of 1:50 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

alpha-Defensin 1 Antibody - BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-94 of human alpha-Defensin 1 (NP_004075.1). MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DEFA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for alpha-Defensin 1 Antibody - BSA Free

• alpha 2
• alphaDefensin 1
• alpha-Defensin 1
• DEF1
• DEF1DEFA1B
• DEFA1
• DEFA2
• defensin, alpha 1, myeloid-related sequence
• defensin, alpha 1HP-1
• HNP-1
• HNP-1HP1
• HP1
• MRS
• MRSMGC138393
• myeloid-related sequence
• neutrophil defensin 1

Background

Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundantin the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine,respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequenceand distinguished by a conserved cysteine motif. Several alpha defensin genes appear to be clustered on chromosome 8.The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likelyplays a role in phagocyte-mediated host defense. It differs from defensin, alpha 3 by only one amino acid. (providedby RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for alpha-Defensin 1 Antibody (NBP3-05562)(1)

Publication using NBP3-05562

• Duan X, Yu Z HNP-1 Reverses Hypertensive Left Ventricular Hypertrophy by Inhibiting the NF-?B Signaling Pathway Cardiovascular Innovations and Applications 2023-08-14 (IHC-P, WB, Rat)
  
  Details:
  1:80 dilution IHC-P, 1:2000 dilution WB

Bioinformatics

• Gene Symbol: DEFA1