AMPK beta 2/PRKAB2 Antibody - BSA Free

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Analysis in human duodenum and tonsil tissues using NBP1-92286 antibody. Corresponding PRKAB2 RNA-seq data are presented for the same tissues

Western Blot: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Analysis in human cell line BEWO.

Immunocytochemistry/Immunofluorescence: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: AMPK beta 2/PRKAB2 Antibody [NBP1-92286] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AMPK beta 2/PRKAB2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MGNTTSDRVSGERHGAKAARSEGAGGHAPGKEHKIMVGSTDDPSVFSLPDSKLPGDKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKEVFISGSF
• Predicted Species: Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRKAB2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AMPK beta 2/PRKAB2 Protein (NBP1-92286PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMPK beta 2/PRKAB2 Antibody - BSA Free

• 5'-AMP-activated protein kinase, beta-2 subunit
• AMPK beta 2
• AMPK beta 2,5'-AMP-activated protein kinase subunit beta-2
• AMPK beta-2 chain
• AMPK subunit beta-2
• MGC61468
• PRKAB2
• protein kinase, AMP-activated, beta 2 non-catalytic subunit

Background

PRKAB2 is encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRKAB2