Angiopoietin-like Protein 2/ANGPTL2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Angiopoietin-like Protein 2/ANGPTL2 Antibody [NBP1-88998] - Staining of human cell line BJ shows localization to the Golgi apparatus. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 2/ANGPTL2 Antibody [NBP1-88998] - Staining of plasma in human small intestine.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Angiopoietin-like Protein 2/ANGPTL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QLENRILNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVP
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANGPTL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100
• Control Peptide:

  Angiopoietin-like Protein 2/ANGPTL2 Protein (NBP1-88998PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Angiopoietin-like Protein 2/ANGPTL2 Antibody - BSA Free

• angiopoietin-like 2
• Angiopoietin-like Protein 2
• angiopoietin-related protein 2
• ANGPTL2
• ANGRP2
• ARP2HARP
• MGC8889

Background

Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largelyspecific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation ofblood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a functionon endothelial cells through autocrine or paracrine action. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPTL2