ATG3/APG3 Antibody (5D2W0)

Western Blot: ATG3/APG3 Antibody (5D2W0) [NBP3-15800] - Western blot analysis of extracts of various cell lines, using ATG3/APG3 antibody (NBP3-15800) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 40s.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: ATG3/APG3 Antibody (5D2W0) [ATG3/APG3] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATG3/APG3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 5D2W0
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATG3/APG3 Antibody (5D2W0) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATG3/APG3 (Q9NT62). MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEE
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ATG3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ATG3/APG3 Antibody (5D2W0)

• APG3 autophagy 3-like (S. cerevisiae)
• APG3
• APG3L
• APG3-LIKE
• Apg3p
• ATG3 autophagy related 3 homolog (S. cerevisiae)
• ATG3
• Autophagy-related protein 3
• DKFZp564M1178
• EC 6.3.2.-
• FLJ22125,2610016C12Rik
• hApg3
• MGC15201
• PC3-96
• Protein PC3-96
• ubiquitin-like-conjugating enzyme ATG3

Background

FUNCTION: GABARAPL1 (GABARAPL2 or GABARAP or MAP1LC3)-modifier protein conjugating enzyme involved in its E2-like covalent binding to PE. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3 (E2-like enzyme). Preferred substrate is MAP1LC3A. Formation of the GABARAPL1-PE conjugate is essential for autophagy. SUBUNIT: Interacts with ATG7 and ATG12. The complex, composed of ATG3 and ATG7, plays a role in the conjugation of ATG12 to ATG5. SUBCELLULAR LOCATION: Cytoplasm. ALTERNATIVE PRODUCTS: 2 named isoformsproduced by alternative splicing. TISSUE SPECIFICITY: Widely expressed, with a highest expression in heart, skeletal muscle, kidney, liver and placenta. SIMILARITY: Belongs to the ATG3 family.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATG3