BYSL Antibody - BSA Free

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human gastrointestinal, lymphoid tissues, placenta and testis using Anti-BYSL antibody NBP1-89501 (A) shows similar protein distribution across tissues to independent antibody NBP1-89500 (B).

Western Blot: BYSL Antibody [NBP1-89501] - Analysis using Anti-BYSL antibody NBP1-89501 (A) shows similar pattern to independent antibody NBP1-89500 (B).

Immunocytochemistry/Immunofluorescence: BYSL Antibody [NBP1-89501] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human testis shows moderate positivity in nucleoli in cells in seminiferous ducts.

Western Blot: BYSL Antibody [NBP1-89501] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human lymph node shows strong positivity in nucleoli in lymphoid cells.

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human placenta shows strong positivity in nucleoli in trophoblastic cells.

Immunohistochemistry-Paraffin: BYSL Antibody [NBP1-89501] - Staining of human rectum shows strong positivity in nucleoli in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BYSL Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BYSL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BYSL Protein (NBP1-89501PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BYSL Antibody - BSA Free

• by the ribosomal protein s6 gene, drosophila, homolog-like
• BYSTIN
• bystin-like

Background

Bystin is expressed as a 2-kb major transcript and a 3.6-kb minor transcript in SNG-M cells and in human trophoblastic teratocarcinoma HT-H cells. Protein binding assays determined that bystin binds directly to trophinin and tastin, and that binding is enhanced when cytokeratins 8 and 18 are present. Immunocytochemistry of HT-H cells showed that bystin colocalizes with trophinin, tastin, and the cytokeratins, suggesting that these molecules form a complex in trophectoderm cells at the time of implantation. Using immunohistochemistry it was determined that trophinin and bystin are found in the placenta from the sixth week of pregnancy. Both proteins were localized in the cytoplasm of the syncytiotrophoblast in the chorionic villi and in endometrial decidual cells at the uteroplacental interface. After week 10, the levels of trophinin, tastin, and bystin decreased and then disappeared from placental villi.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BYSL Antibody (NBP1-89501)(1)

Publication using NBP1-89501

• Zhang J, Tang H, Jiang X et al. Hypoxia-Induced miR-378a-3p Inhibits Osteosarcoma Invasion and Epithelial-to-Mesenchymal Transition via BYSL Regulation Frontiers in Genetics 2022-01-28 [PMID: 35154253] (Western Blot, Block/Neutralize)

Bioinformatics

• Gene Symbol: BYSL