c-Myc-responsive protein Rcl Antibody - BSA Free

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Analysis in human duodenum and testis tissues. Corresponding c-Myc-responsive protein Rcl RNA-seq data are presented for the same tissues.

Western Blot: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Staining of human duodenum shows high expression.

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: c-Myc-responsive protein Rcl Antibody [NBP1-85180] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

c-Myc-responsive protein Rcl Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNPH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  c-Myc-responsive protein Rcl Protein (NBP1-85180PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (86%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for c-Myc-responsive protein Rcl Antibody - BSA Free

• chromosome 6 open reading frame 108
• c-Myc-responsive protein Rcl
• deoxyribonucleoside 5'-monophosphate N-glycosidase
• dJ330M21.3
• EC 3.2.2
• EC 3.2.2.-
• putative c-Myc-responsive
• rcl
• RP3-330M21.3

Background

C6orf108 was identified on the basis of its stimulation by c-Myc protein. The latter is a transcription factor that participates in the regulation of cell proliferation, differentiation, and apoptosis. The exact function of this gene is not known but studies in rat suggest a role in cellular proliferation and c-Myc-mediated transformation. Two alternative transcripts encoding different proteins have been described. [provided by RefSeq]. Transcript Variant: This variant (1) encodes the longer isoform (1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNPH1