C9orf72 Antibody - BSA Free

Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: C9orf72 Antibody [NBP1-93504] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

C9orf72 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI
• Predicted Species: Mouse (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C9orf72
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in WB reported in scientific literature (PMID: 30003873). Use in ICC/IF reported in scientic literature (PMID: 25521377).
• Control Peptide:

  C9orf72 Protein (NBP1-93504PEP)

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 25521377).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for C9orf72 Antibody - BSA Free

• ALSFTD
• C9orf72
• chromosome 9 open reading frame 72
• DENNL72
• FTDALS
• FTDALS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C9orf72 Antibody (NBP1-93504)(5)

Publications using NBP1-93504

• Conlon EG, Fagegaltier D, Agius P et al. Unexpected similarities between C9ORF72 and sporadic forms of ALS/FTD suggest a common disease mechanism Elife 2018-07-13 [PMID: 30003873] (WB, Human)
• Wen X, Tan W, Westergard T et al. Antisense Proline-Arginine RAN dipeptides linked to C9ORF72-ALS/FTD form toxic nuclear aggregates that initiate in vitro and in vivo neuronal death. Neuron 2014-12-17 [PMID: 25521377] (ICC/IF, Rat)
• Satoh JI, Tabunoki H, Ishida T et al. Dystrophic neurites express C9orf72 in Alzheimers disease brains. Alzheimers Res Ther 2012-08-16 [PMID: 22898310]
• Brettschneider J, Van Deerlin VM, Robinson JL et al. Pattern of ubiquilin pathology in ALS and FTLD indicates presence of C9ORF72 hexanucleotide expansion. Acta Neuropathol 2012-06-01 [PMID: 22426854]
• Snowden JS, Rollinson S, Thompson JC et al. Distinct clinical and pathological characteristics of frontotemporal dementia associated with C9ORF72 mutations. Brain 2012-03-01 [PMID: 22300873]

Bioinformatics

• Gene Symbol: C9orf72
• Entrez:
  • 203228(Human)
• Uniprot:
  • Q96LT7(Human)