CaMKII beta Antibody - BSA Free

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Analysis in human cerebral cortex and placenta tissues. Corresponding RNA-seq data are presented for the same tissues

Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Immunohistochemistry: CaMKII beta Antibody [NBP1-88212] - Staining of mouse brain shows moderate to strong positivity in more than 75 % of neurons in the cerebral cortex.

Western Blot: CaMKII beta Antibody [NBP1-88212] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Cerebral Cortex

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human heart shows weak to moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: CaMKII beta Antibody [NBP1-88212] - Staining of human placenta shows no positivity in trophoblastic cells as expected.

Simple Western: CaMKII beta Antibody [NBP1-88212] - Simple Western lane view shows a specific band for CaMKII beta in 0.2 mg/ml of H. Motor Cortex lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.

Simple Western: CaMKII beta Antibody [NBP1-88212] - Electropherogram image of the corresponding Simple Western lane view. CaMKII beta antibody was used at 1:5 dilution on H. Motor Cortex lysate(s) respectively.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CaMKII beta Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
• Predicted Species: Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAMK2B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:5
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in H. Motor Cortex lysates, separated by Size, antibody dilution of 1:5

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CaMKII beta Antibody - BSA Free

• calcium/calmodulin-dependent protein kinase (CaM kinase) II beta
• calcium/calmodulin-dependent protein kinase II beta
• calcium/calmodulin-dependent protein kinase type II beta chain
• calcium/calmodulin-dependent protein kinase type II subunit beta
• CaM kinase II beta subunit
• CaM kinase II subunit beta
• CAM2
• CAM2CAMK2
• CAMKB
• CaMKII beta
• CaMK-II subunit beta
• CaM-kinase II beta chain
• EC 2.7.11
• EC 2.7.11.17
• MGC29528
• proline rich calmodulin-dependent protein kinase

Background

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAMK2B