![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Analysis in human liver and skeletal muscle tissues using NBP1-85751 antibody. Corresponding ENTPD5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0017.jpg "Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Analysis in human liver and skeletal muscle tissues using NBP1-85751 antibody. Corresponding ENTPD5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ENTPD5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. See Simple Western Antibody Database for Simple Western validation: Tested in h. Liver lysate(s), separated by Size, antibody dilution of 1:25, apparent MW was 57 kDa. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![CD39L2/ENTPD6 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "CD39L2/ENTPD6 Antibody [Unconjugated]")
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-85751 | Applications | Species |
|---|---|---|
| Horak P, Tomasich E, Vanhara P et al. TUSC3 Loss Alters the ER Stress Response and Accelerates Prostate Cancer Growth in vivo. Sci Rep 2014-01-17 [PMID: 24435307] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD39L4/ENTPD5 Antibody (NBP1-85751)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ENTPD5 |
![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0012.jpg "Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0013.jpg "Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.")
![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0014.jpg "Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Immunohistochemistry-Paraffin-NBP1-85751-img0015.jpg "Immunohistochemistry-Paraffin: CD39L4/ENTPD5 Antibody [NBP1-85751] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Simple Western lane view shows a specific band for CD39L4/ENTPD5 in 0.2 mg/ml of h. Liver lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Simple-Western-NBP1-85751-img0006.jpg "Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Simple Western lane view shows a specific band for CD39L4/ENTPD5 in 0.2 mg/ml of h. Liver lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Electropherogram image of the corresponding Simple Western lane view. CD39L4/ENTPD5 antibody was used at 1:25 dilution on h. Liver lysate(s) respectively.](http://images.novusbio.com/fullsize/CD39L4-ENTPD5-Antibody-Simple-Western-NBP1-85751-img0008.jpg "Simple Western: CD39L4/ENTPD5 Antibody [NBP1-85751] - Electropherogram image of the corresponding Simple Western lane view. CD39L4/ENTPD5 antibody was used at 1:25 dilution on h. Liver lysate(s) respectively.")
![Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Liver tissue](http://images.novusbio.com/fullsize/nbp1-85751_rabbit-polyclonal-cd39l4-entpd5-antibody-24420259374134.jpg "Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Liver tissue")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Knockout Validated Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Knockout_Validated_22540.jpg)
![Immunocytochemistry Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Immunocytochemistry__Immunofluorescence_19067.jpg)
![Western Blot Isocitrate Dehydrogenase 1/IDH1 Antibody (843219) [Unconjugated]](https://images.novusbio.com/images2/Isocitrate_Dehydrogenase_1_MAB7049_Western_Blot_13853.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Simple Western CD39L3/ENTPD3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4464_mouse-cd39l3-entpd3-affinity-purified-polyclonal-ab-simple-western-2510202213255.jpg)
![Western Blot CD39L3/ENTPD3 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4464_mouse-cd39l3-entpd3-affinity-purified-polyclonal-ab-western-blot-25102022133117.jpg)
![Western Blot CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD39L1_AF5797_Western_Blot_9441.jpg)
![Immunocytochemistry/ Immunofluorescence CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images/af5797_mouse-rat-cd39l1-entpd2-affinity-purified-polyclonal-ab-41202412394941.jpg)
![Immunocytochemistry/ Immunofluorescence CD39L1/ENTPD2 Antibody [Unconjugated]](https://images.novusbio.com/images/af5797_mouse-rat-cd39l1-entpd2-affinity-purified-polyclonal-ab-41202412401213.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")