CDC42 Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 25-191 of human CDC42 (NP_001782.1). TNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CDC42 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin 1:400
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for CDC42 Antibody
Background
CDC42 is a small GTPase of the Rho subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc42, and is able to complement the yeast cdc42 1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott Aldrich syndrome protein (NWASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in at least two transcript variants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: WB, IHC
Publications for CDC42 Antibody (NBP3-06684) (0)
There are no publications for CDC42 Antibody (NBP3-06684).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CDC42 Antibody (NBP3-06684) (0)
There are no reviews for CDC42 Antibody (NBP3-06684).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CDC42 Antibody (NBP3-06684) (0)